Basic Information | |
---|---|
Family ID | F101993 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 102 |
Average Sequence Length | 41 residues |
Representative Sequence | MSLLWLRFALACYFIGLVYAFVALTRTSDLFSRIALHAASLGM |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 102 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 49.02 % |
% of genes near scaffold ends (potentially truncated) | 99.02 % |
% of genes from short scaffolds (< 2000 bps) | 89.22 % |
Associated GOLD sequencing projects | 92 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (86.275 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.765 % of family members) |
Environment Ontology (ENVO) | Unclassified (22.549 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (49.020 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 86.05% β-sheet: 0.00% Coil/Unstructured: 13.95% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 102 Family Scaffolds |
---|---|---|
PF08447 | PAS_3 | 2.94 |
PF00578 | AhpC-TSA | 1.96 |
PF13360 | PQQ_2 | 1.96 |
PF00150 | Cellulase | 1.96 |
PF13671 | AAA_33 | 1.96 |
PF13561 | adh_short_C2 | 0.98 |
PF01384 | PHO4 | 0.98 |
PF00903 | Glyoxalase | 0.98 |
PF13401 | AAA_22 | 0.98 |
PF01578 | Cytochrom_C_asm | 0.98 |
PF00248 | Aldo_ket_red | 0.98 |
PF01061 | ABC2_membrane | 0.98 |
PF05192 | MutS_III | 0.98 |
PF12876 | Cellulase-like | 0.98 |
PF06452 | CBM9_1 | 0.98 |
PF01977 | UbiD | 0.98 |
PF01210 | NAD_Gly3P_dh_N | 0.98 |
PF13924 | Lipocalin_5 | 0.98 |
PF13732 | DUF4162 | 0.98 |
PF01624 | MutS_I | 0.98 |
COG ID | Name | Functional Category | % Frequency in 102 Family Scaffolds |
---|---|---|---|
COG0249 | DNA mismatch repair ATPase MutS | Replication, recombination and repair [L] | 1.96 |
COG2730 | Aryl-phospho-beta-D-glucosidase BglC, GH1 family | Carbohydrate transport and metabolism [G] | 1.96 |
COG3934 | Endo-1,4-beta-mannosidase | Carbohydrate transport and metabolism [G] | 1.96 |
COG0043 | 3-polyprenyl-4-hydroxybenzoate decarboxylase | Coenzyme transport and metabolism [H] | 0.98 |
COG0306 | Phosphate/sulfate permease | Inorganic ion transport and metabolism [P] | 0.98 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 86.27 % |
Unclassified | root | N/A | 13.73 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300001175|JGI12649J13570_1008947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia | 1214 | Open in IMG/M |
3300002245|JGIcombinedJ26739_100662600 | All Organisms → cellular organisms → Bacteria | 921 | Open in IMG/M |
3300002245|JGIcombinedJ26739_101054222 | All Organisms → cellular organisms → Bacteria | 699 | Open in IMG/M |
3300004091|Ga0062387_100741904 | All Organisms → cellular organisms → Bacteria | 724 | Open in IMG/M |
3300004092|Ga0062389_101685706 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
3300005177|Ga0066690_10105804 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1812 | Open in IMG/M |
3300005178|Ga0066688_10663941 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 666 | Open in IMG/M |
3300005435|Ga0070714_102319400 | Not Available | 522 | Open in IMG/M |
3300005560|Ga0066670_10396878 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 845 | Open in IMG/M |
3300005602|Ga0070762_10555802 | All Organisms → cellular organisms → Bacteria | 758 | Open in IMG/M |
3300005876|Ga0075300_1040237 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 652 | Open in IMG/M |
3300006032|Ga0066696_10542307 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 761 | Open in IMG/M |
3300006102|Ga0075015_101022319 | All Organisms → cellular organisms → Bacteria | 507 | Open in IMG/M |
3300006163|Ga0070715_10060813 | All Organisms → cellular organisms → Bacteria | 1657 | Open in IMG/M |
3300006174|Ga0075014_100981273 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 511 | Open in IMG/M |
3300006893|Ga0073928_10084761 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2704 | Open in IMG/M |
3300006893|Ga0073928_10249818 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1356 | Open in IMG/M |
3300006893|Ga0073928_10944951 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → unclassified Terriglobales → Acidobacteriales bacterium 13_2_20CM_55_8 | 589 | Open in IMG/M |
3300009552|Ga0116138_1059636 | All Organisms → cellular organisms → Bacteria | 1083 | Open in IMG/M |
3300009636|Ga0116112_1168400 | Not Available | 609 | Open in IMG/M |
3300009644|Ga0116121_1320370 | Not Available | 501 | Open in IMG/M |
3300009698|Ga0116216_10473205 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 758 | Open in IMG/M |
3300009787|Ga0116226_11743898 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 570 | Open in IMG/M |
3300009824|Ga0116219_10081126 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1899 | Open in IMG/M |
3300010339|Ga0074046_10681751 | All Organisms → cellular organisms → Bacteria | 604 | Open in IMG/M |
3300010343|Ga0074044_10725696 | All Organisms → cellular organisms → Bacteria | 649 | Open in IMG/M |
3300010343|Ga0074044_11111803 | Not Available | 517 | Open in IMG/M |
3300012356|Ga0137371_10729630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 757 | Open in IMG/M |
3300012944|Ga0137410_11998379 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 515 | Open in IMG/M |
3300014168|Ga0181534_10080846 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1614 | Open in IMG/M |
3300014657|Ga0181522_10577630 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 681 | Open in IMG/M |
3300017924|Ga0187820_1328355 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 507 | Open in IMG/M |
3300017943|Ga0187819_10476162 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 713 | Open in IMG/M |
3300017948|Ga0187847_10005630 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 8976 | Open in IMG/M |
3300017972|Ga0187781_11246063 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 548 | Open in IMG/M |
3300017973|Ga0187780_10641339 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 764 | Open in IMG/M |
3300017999|Ga0187767_10315694 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
3300018003|Ga0187876_1231554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 609 | Open in IMG/M |
3300018007|Ga0187805_10008527 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Koribacter → Candidatus Koribacter versatilis | 4247 | Open in IMG/M |
3300018009|Ga0187884_10436021 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 527 | Open in IMG/M |
3300018023|Ga0187889_10277196 | Not Available | 747 | Open in IMG/M |
3300018042|Ga0187871_10831018 | Not Available | 516 | Open in IMG/M |
3300018047|Ga0187859_10126513 | All Organisms → cellular organisms → Bacteria | 1349 | Open in IMG/M |
3300018085|Ga0187772_10526783 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 835 | Open in IMG/M |
3300018086|Ga0187769_11305407 | Not Available | 549 | Open in IMG/M |
3300018090|Ga0187770_10846854 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 733 | Open in IMG/M |
3300018433|Ga0066667_11915446 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300020579|Ga0210407_11058915 | All Organisms → cellular organisms → Bacteria | 616 | Open in IMG/M |
3300020581|Ga0210399_10270825 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1417 | Open in IMG/M |
3300020581|Ga0210399_10843607 | All Organisms → cellular organisms → Bacteria | 746 | Open in IMG/M |
3300021088|Ga0210404_10240002 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 983 | Open in IMG/M |
3300021171|Ga0210405_11324417 | All Organisms → cellular organisms → Bacteria | 528 | Open in IMG/M |
3300021180|Ga0210396_11234551 | All Organisms → cellular organisms → Bacteria | 624 | Open in IMG/M |
3300021401|Ga0210393_10124737 | All Organisms → cellular organisms → Bacteria | 2061 | Open in IMG/M |
3300021405|Ga0210387_11269885 | All Organisms → cellular organisms → Bacteria | 637 | Open in IMG/M |
3300021407|Ga0210383_11449743 | Not Available | 569 | Open in IMG/M |
3300021433|Ga0210391_10020091 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales | 5385 | Open in IMG/M |
3300021479|Ga0210410_11087384 | All Organisms → cellular organisms → Bacteria | 690 | Open in IMG/M |
3300025412|Ga0208194_1031093 | Not Available | 842 | Open in IMG/M |
3300025898|Ga0207692_10691255 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 661 | Open in IMG/M |
3300025924|Ga0207694_10853704 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 769 | Open in IMG/M |
3300025928|Ga0207700_10494155 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1082 | Open in IMG/M |
3300026555|Ga0179593_1045185 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2325 | Open in IMG/M |
3300026833|Ga0207728_115363 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 700 | Open in IMG/M |
3300027559|Ga0209222_1082227 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 622 | Open in IMG/M |
3300027591|Ga0209733_1083160 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 820 | Open in IMG/M |
3300027648|Ga0209420_1037531 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus | 1495 | Open in IMG/M |
3300027737|Ga0209038_10220540 | Not Available | 571 | Open in IMG/M |
3300027821|Ga0209811_10433878 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 509 | Open in IMG/M |
3300027824|Ga0209040_10268462 | All Organisms → cellular organisms → Bacteria | 847 | Open in IMG/M |
3300027854|Ga0209517_10666209 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 541 | Open in IMG/M |
3300027869|Ga0209579_10533550 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 637 | Open in IMG/M |
3300027908|Ga0209006_10708997 | All Organisms → cellular organisms → Bacteria | 823 | Open in IMG/M |
3300027911|Ga0209698_10291789 | Not Available | 1293 | Open in IMG/M |
3300028798|Ga0302222_10024415 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 2481 | Open in IMG/M |
3300029939|Ga0311328_11075391 | Not Available | 520 | Open in IMG/M |
3300029944|Ga0311352_10286554 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1376 | Open in IMG/M |
3300029952|Ga0311346_11374920 | Not Available | 536 | Open in IMG/M |
3300030007|Ga0311338_11108454 | All Organisms → cellular organisms → Bacteria | 759 | Open in IMG/M |
3300030580|Ga0311355_10318637 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 89 | 1555 | Open in IMG/M |
3300030580|Ga0311355_10860737 | All Organisms → cellular organisms → Bacteria | 827 | Open in IMG/M |
3300030646|Ga0302316_10071039 | All Organisms → cellular organisms → Bacteria | 1523 | Open in IMG/M |
3300030659|Ga0316363_10086194 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1415 | Open in IMG/M |
3300030879|Ga0265765_1033255 | All Organisms → cellular organisms → Bacteria | 664 | Open in IMG/M |
3300030940|Ga0265740_1048951 | All Organisms → cellular organisms → Bacteria | 517 | Open in IMG/M |
3300031128|Ga0170823_12808762 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 564 | Open in IMG/M |
3300031231|Ga0170824_119674333 | Not Available | 539 | Open in IMG/M |
3300031469|Ga0170819_10950787 | All Organisms → cellular organisms → Bacteria | 826 | Open in IMG/M |
3300031525|Ga0302326_10954344 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1211 | Open in IMG/M |
3300031573|Ga0310915_10878198 | All Organisms → cellular organisms → Bacteria | 629 | Open in IMG/M |
3300031753|Ga0307477_10097571 | All Organisms → cellular organisms → Bacteria | 2042 | Open in IMG/M |
3300031823|Ga0307478_10856151 | All Organisms → cellular organisms → Bacteria | 761 | Open in IMG/M |
3300032180|Ga0307471_100127966 | All Organisms → cellular organisms → Bacteria | 2386 | Open in IMG/M |
3300032180|Ga0307471_100167947 | All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae | 2142 | Open in IMG/M |
3300032180|Ga0307471_102038360 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 720 | Open in IMG/M |
3300032782|Ga0335082_10279877 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1545 | Open in IMG/M |
3300032782|Ga0335082_11313536 | All Organisms → cellular organisms → Bacteria | 592 | Open in IMG/M |
3300032828|Ga0335080_11151873 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 782 | Open in IMG/M |
3300032892|Ga0335081_10012090 | All Organisms → cellular organisms → Bacteria | 13985 | Open in IMG/M |
3300032892|Ga0335081_10728847 | All Organisms → cellular organisms → Bacteria → Acidobacteria | 1197 | Open in IMG/M |
3300032893|Ga0335069_10510918 | All Organisms → cellular organisms → Bacteria | 1392 | Open in IMG/M |
3300033818|Ga0334804_089159 | All Organisms → cellular organisms → Bacteria | 815 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.76% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 6.86% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 6.86% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 5.88% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.88% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.88% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.90% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 3.92% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 3.92% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 3.92% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 2.94% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 2.94% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.94% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.94% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 2.94% |
Bog Forest Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil | 2.94% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.94% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 1.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.96% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.96% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 1.96% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.98% |
Rice Paddy Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil | 0.98% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 0.98% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.98% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 0.98% |
Soil | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Soil | 0.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.98% |
Host-Associated | Host-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated | 0.98% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300001175 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 | Environmental | Open in IMG/M |
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300004091 | Coassembly of ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300004092 | Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3 | Environmental | Open in IMG/M |
3300005177 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139 | Environmental | Open in IMG/M |
3300005178 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 | Environmental | Open in IMG/M |
3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Environmental | Open in IMG/M |
3300005560 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_119 | Environmental | Open in IMG/M |
3300005602 | Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2 | Environmental | Open in IMG/M |
3300005876 | Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_25C_80N_401 | Environmental | Open in IMG/M |
3300006032 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_145 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300009552 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_150 | Environmental | Open in IMG/M |
3300009636 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150 | Environmental | Open in IMG/M |
3300009644 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009787 | Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MG | Host-Associated | Open in IMG/M |
3300009824 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaG | Environmental | Open in IMG/M |
3300010339 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM3 | Environmental | Open in IMG/M |
3300010343 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1 | Environmental | Open in IMG/M |
3300012356 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaG | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300014168 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaG | Environmental | Open in IMG/M |
3300014657 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_10_metaG | Environmental | Open in IMG/M |
3300017924 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_5 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017948 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10 | Environmental | Open in IMG/M |
3300017972 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
3300018003 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_40 | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018009 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40 | Environmental | Open in IMG/M |
3300018023 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100 | Environmental | Open in IMG/M |
3300018042 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10 | Environmental | Open in IMG/M |
3300018047 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10 | Environmental | Open in IMG/M |
3300018085 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018086 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_10_MG | Environmental | Open in IMG/M |
3300018090 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300018433 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_116 | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300020581 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-M | Environmental | Open in IMG/M |
3300021088 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-M | Environmental | Open in IMG/M |
3300021171 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-M | Environmental | Open in IMG/M |
3300021180 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-O | Environmental | Open in IMG/M |
3300021401 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-O | Environmental | Open in IMG/M |
3300021405 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-O | Environmental | Open in IMG/M |
3300021407 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-O | Environmental | Open in IMG/M |
3300021433 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-O | Environmental | Open in IMG/M |
3300021479 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-M | Environmental | Open in IMG/M |
3300025412 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300026555 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300026833 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 54 (SPAdes) | Environmental | Open in IMG/M |
3300027559 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_Ref_O3 (SPAdes) | Environmental | Open in IMG/M |
3300027591 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027648 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O1 (SPAdes) | Environmental | Open in IMG/M |
3300027737 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027854 | Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes) | Environmental | Open in IMG/M |
3300027869 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027908 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_Ref_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027911 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300028798 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2 | Environmental | Open in IMG/M |
3300029939 | I_Bog_E3 coassembly | Environmental | Open in IMG/M |
3300029944 | II_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029952 | II_Bog_N3 coassembly | Environmental | Open in IMG/M |
3300030007 | I_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030646 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_2 | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300030940 | Metatranscriptome of soil microbial communities from Maridalen valley, Oslo, Norway - NSI1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031128 | Oak Summer Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031469 | Fir Spring Coassembly Site 11 - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031525 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3 | Environmental | Open in IMG/M |
3300031573 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111 | Environmental | Open in IMG/M |
3300031753 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM2C_515 | Environmental | Open in IMG/M |
3300031823 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_05 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032782 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033818 | Peat soil microbial communities from Stordalen Mire, Sweden - 713 S-3-M | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGI12649J13570_10089471 | 3300001175 | Forest Soil | MALLWLRFALACYFVGLIYAFFALSRTSDLFSRIALHAASLGMVFHF |
JGIcombinedJ26739_1006626002 | 3300002245 | Forest Soil | MSLLWLRFALGCYLIGLIYAFVALNRTSDLFSRIALHAATLGMV |
JGIcombinedJ26739_1010542222 | 3300002245 | Forest Soil | MALLWLRVALACYFVGLIYAFFALTRTSDLFSRIALHAASL |
Ga0062387_1007419042 | 3300004091 | Bog Forest Soil | MALLWLRFALACYFIGLTYAFFALTRTSDLFSRIALHAASLGM |
Ga0062389_1016857061 | 3300004092 | Bog Forest Soil | MALLWLRFALACYFIGLIYAFFALRRTSDLFSRIALHAASLG |
Ga0066690_101058041 | 3300005177 | Soil | MGPMSLLWLRFALGCYFIGLIYAFVALSRTSDLFSRIALHAASLGMVF |
Ga0066688_106639411 | 3300005178 | Soil | MALLWLRFALACYLLGLVYAFVALTRTSDLFSRIALHAASLG |
Ga0070714_1023194002 | 3300005435 | Agricultural Soil | MSLLWLRFALACYFIGLTYAFFALSRTSDLFSRIALHAASLGMV |
Ga0066670_103968783 | 3300005560 | Soil | MSLLWLRFALGCYFVGLVYAFVALTRTSDLFSRIALHAATIG |
Ga0070762_105558022 | 3300005602 | Soil | MALLWLRFALACYFIGLIYAFFALTRTSDLFSRIALHAASLGMVF |
Ga0075300_10402372 | 3300005876 | Rice Paddy Soil | MSLLWLRFALGCYFVGLVYAFVALSRTSDLFSRIALHAASL |
Ga0066696_105423072 | 3300006032 | Soil | MGPMSLLWLRFALGCYFIGLIYAFVALSRTSDLFSRIALHAASLGM |
Ga0075015_1010223191 | 3300006102 | Watersheds | MSLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHAASLGMVFH |
Ga0070715_100608131 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLLWLRFALGCYLVGLVYAFVALTRTSDLFSRVAFHAASMGMV |
Ga0075014_1009812732 | 3300006174 | Watersheds | MSLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALH |
Ga0073928_100847611 | 3300006893 | Iron-Sulfur Acid Spring | MSLLWLRFALGCYFISLIYAFVALTRTSDLFSRIA |
Ga0073928_102498181 | 3300006893 | Iron-Sulfur Acid Spring | MSLLWLRCALGCYFVSLIYAFVALTRTRDLFSRIALHAA |
Ga0073928_109449512 | 3300006893 | Iron-Sulfur Acid Spring | MSLLWLRFALACYFIGLTYAFFALSRTSDLFSRIALHAASLGMVFHF |
Ga0116138_10596361 | 3300009552 | Peatland | MALLWLRFALACYFIGLIYAFFALTRTSDLFSRIA |
Ga0116112_11684002 | 3300009636 | Peatland | MALLWLRFALACYFIGLIYAFFALSRTSELFSRIALHAASMGMVFH |
Ga0116121_13203701 | 3300009644 | Peatland | MALLWLRFALACYFIGLIYAFFALTRTSDLFSRIALHAASM |
Ga0116216_104732052 | 3300009698 | Peatlands Soil | MSLLWLRFALGCYFIGLIYAFVALTRTSDLFSRIALHAASLGMVFHF |
Ga0116226_117438982 | 3300009787 | Host-Associated | MALLWLRFALACYFIGLIYAFFALSRTSDLFSRIALHAASLGMVF |
Ga0116219_100811263 | 3300009824 | Peatlands Soil | MSLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHAA |
Ga0074046_106817511 | 3300010339 | Bog Forest Soil | MSLLWLRFALACYFIGLIYAFFALSRTSDLFSRIALHA |
Ga0074044_107256962 | 3300010343 | Bog Forest Soil | MALLWLRFALACYFVGLIYAFVALSRTSDLFSRIALHAVSL |
Ga0074044_111118031 | 3300010343 | Bog Forest Soil | MSLLWLRFALACYFIGLIYAFFALTRTSDLFSRIA |
Ga0137371_107296301 | 3300012356 | Vadose Zone Soil | MSLLWLRFALACYFIGLVYAFVALSRTSDLFSRIALHAASLG |
Ga0137410_119983791 | 3300012944 | Vadose Zone Soil | MSLLWLRFALGCYFVGLVYAFVALTRPSDLFSRIALHAATMGMVF |
Ga0181534_100808462 | 3300014168 | Bog | MALLWLRFALACYCVGLIYAFVALSRTSDLFSRIA* |
Ga0181522_105776301 | 3300014657 | Bog | MSLLWLRFALACYFVGLVYAFVALTRTSELFSRIALHAA |
Ga0187820_13283552 | 3300017924 | Freshwater Sediment | MSLLWLRFALGCYFISLIYAFVALSRTSDLFSRIALH |
Ga0187819_104761621 | 3300017943 | Freshwater Sediment | MALLWLRFALGCYFIGLIYAFVALTRPSDLFSRIALHAASLGMVFHF |
Ga0187847_100056307 | 3300017948 | Peatland | MSLLWLRFALGCYFIGLVYAFVALSRTSDLFSRIALHAASLGMVFH |
Ga0187781_112460632 | 3300017972 | Tropical Peatland | MSLLWLRFALGCYFIGLIYAFFALTRTSDLFSRIALHAASLGMVF |
Ga0187780_106413391 | 3300017973 | Tropical Peatland | MSLLWLRFALACYFIGLVYAFVALSRTSDLFARIALHAASL |
Ga0187767_103156942 | 3300017999 | Tropical Peatland | MSLLWLRFALACYFIGLVYAFVALTRTSDLFSRIAL |
Ga0187876_12315542 | 3300018003 | Peatland | MSLLWLRFALGCYFIGLVYAFVALSRTSDLFARIALHAASLGMVF |
Ga0187805_100085275 | 3300018007 | Freshwater Sediment | MSLLWLRFALACYFIGLVYAFVALHRTSDLFSRIALHAA |
Ga0187884_104360211 | 3300018009 | Peatland | MALLWLRFALGCYFIGLIYAFFALSRTSDLFSRIALHAASLGMVF |
Ga0187889_102771963 | 3300018023 | Peatland | MALLWLRFALACYFIGLIYAFFALSRTSDLFSRIALHAASL |
Ga0187871_108310181 | 3300018042 | Peatland | MALLWLRFALACYFIGLIYAFFALSRTSDLFSRIA |
Ga0187859_101265131 | 3300018047 | Peatland | MALLWLRFALACYCVGLIYAFVALTRPSDLFSRIALHAV |
Ga0187772_105267831 | 3300018085 | Tropical Peatland | MSLLWLRFALACYFIGLVYAFVALRRTSDLFARIALHAASLGMV |
Ga0187769_113054071 | 3300018086 | Tropical Peatland | MALLWLRFALACYFVGLIYAFFALTRTSELFSRIALHAASL |
Ga0187770_108468542 | 3300018090 | Tropical Peatland | MSLLWLRFALGCYFIGLIYAFVALTRTSDLFSRIALH |
Ga0066667_119154461 | 3300018433 | Grasslands Soil | MGPMSLLWLRFALGCYFIGLIYAFVALSRTSDLFSRIALHAAS |
Ga0210407_110589152 | 3300020579 | Soil | MALLWLRFALACYFIGLIYAFFALRRTSDLFSRIALHAAS |
Ga0210399_102708251 | 3300020581 | Soil | MALLWLRFALGCYFIGLIYAFFALSRTSDRFSRIALHAASLGMV |
Ga0210399_108436071 | 3300020581 | Soil | MSLLWLRFALACYFIGLIYAFFALTRTSDLFSRIALHAASLGM |
Ga0210404_102400022 | 3300021088 | Soil | MSLLWLRFALGCYFVGLVYAFVALTRTSDLFSRIA |
Ga0210405_113244171 | 3300021171 | Soil | MSLLWLRFALACYFIGLIYAFFALTRPSDLFSRIALHAASLG |
Ga0210396_112345511 | 3300021180 | Soil | MSLLWLRFALACYFIGLVYAFVALTRTSDLFSRIALHAASLGM |
Ga0210393_101247374 | 3300021401 | Soil | MALLWLRFALACYFIGLIYAFFALSRTSDLFSRIAFHAAS |
Ga0210387_112698851 | 3300021405 | Soil | MSLLWLRFALACYFIGLVYAFVALRRTSDLFSRVALHAASLGMVF |
Ga0210383_114497432 | 3300021407 | Soil | MALLWLRFALACYCVGLIYAFVALARPSDLFSRIA |
Ga0210391_100200911 | 3300021433 | Soil | MALLWLRFALACYFVGLIYAFFALTRTSDLFSRIALHAASL |
Ga0210410_110873842 | 3300021479 | Soil | MSLLWLRFALACYFIGLVYAFVALRRTSDLFSRVALHAAS |
Ga0208194_10310931 | 3300025412 | Peatland | MALLWLRFALACYFIGLIYAFFALSRTSDLFSRIALH |
Ga0207692_106912552 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MPLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHAAS |
Ga0207694_108537041 | 3300025924 | Corn Rhizosphere | MSLLWLRFALGCYFIGLIYAFVALRRTSDLFSRIALH |
Ga0207700_104941551 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLLWLRFALACYFIGLVYAFVALTRTSDLFSRIALHAASLGMVFH |
Ga0179593_10451851 | 3300026555 | Vadose Zone Soil | MSLLWLRFALACYFVGLIYAFFALTRTSDLFSRIALHAASL |
Ga0207728_1153631 | 3300026833 | Tropical Forest Soil | MSLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHAVSLGMVFH |
Ga0209222_10822272 | 3300027559 | Forest Soil | MALLWLRFALACYFIGLIYAFFALTRTSDLFSRIALHAASLGMVFHLVS |
Ga0209733_10831601 | 3300027591 | Forest Soil | MALLWLRFALACYLLGLVYAFVALTRTSDLFSRIALH |
Ga0209420_10375313 | 3300027648 | Forest Soil | MSLLWLRFALACYFIGLIYAFFALSRTSDLFSRIALHAACLGMVFHF |
Ga0209038_102205401 | 3300027737 | Bog Forest Soil | MSLLWLRFALACYFIGLIYAFFALTRTSDLFSRIALHVASLGM |
Ga0209811_104338781 | 3300027821 | Surface Soil | MSLLWLRFALGCYFIGLVYAFVALRRTSDLFSRIAFHAA |
Ga0209040_102684622 | 3300027824 | Bog Forest Soil | MSLLWLRFALACYFIGLTYAFFALTRTSDLFSRIALHAASLGMVFH |
Ga0209517_106662091 | 3300027854 | Peatlands Soil | MSLLWLRFALACYLIGLVYAFVALSRTSDMFSRIAL |
Ga0209579_105335502 | 3300027869 | Surface Soil | MPLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHAASLGMVFHF |
Ga0209006_107089972 | 3300027908 | Forest Soil | MPLLWLRFALACYFVGLIYAFVALARPSDLFSRIALHAV |
Ga0209698_102917892 | 3300027911 | Watersheds | MSLLWLRFALGCYFVGLVYAFVALTRTSDLFSRIALHAAT |
Ga0302222_100244153 | 3300028798 | Palsa | MSLLWLRFALACYFIGLIYAFFALSRTSDLFSRIALHAASLGMVFHF |
Ga0311328_110753912 | 3300029939 | Bog | MALLWLRFALACYFIGLTYAFFALTRTSDLFSRIALHAASL |
Ga0311352_102865541 | 3300029944 | Palsa | MSLLWLRFALACYFIGLVYAFFALTRTSDMFSRIALHA |
Ga0311346_113749201 | 3300029952 | Bog | MALLWLRFALACYFIGLTYAFFALTRTSDLFSRIALHAAS |
Ga0311338_111084541 | 3300030007 | Palsa | MSLLWLRFALACYFIGLTYAFFALSRTSDLFSRIA |
Ga0311355_103186373 | 3300030580 | Palsa | MSLLWLRFALACYFIGLVYAFFALTRTSDMFSRIALH |
Ga0311355_108607372 | 3300030580 | Palsa | MALLWLRFALACYCVGLIYAFVALTRTSDLFSRIALHAV |
Ga0302316_100710393 | 3300030646 | Palsa | MSLLWLRFALACYFIGLTYAFFALSRTSDLFSRIALHAAS |
Ga0316363_100861943 | 3300030659 | Peatlands Soil | MSLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHA |
Ga0265765_10332551 | 3300030879 | Soil | MALLWLRFALACYFIGLIYAFFALTRTSDLFSRIALHAASLGMVFHF |
Ga0265740_10489512 | 3300030940 | Soil | MPLLWLRFALACYFVGLIYAFFALSRTSDLFSRIAL |
Ga0170823_128087622 | 3300031128 | Forest Soil | MSLLWLRFALGCYFISLIYAFVALTRTSDLFSRVALHAASLGMVF |
Ga0170824_1196743332 | 3300031231 | Forest Soil | MSLLWLRFALGCYFISLIYAFVALTRTSDLFSRVAL |
Ga0170819_109507871 | 3300031469 | Forest Soil | MSLLWLRFALGCYFISLIYAFVALTRTSDLFSRIALHAASL |
Ga0302326_109543441 | 3300031525 | Palsa | MSLLWLRFALGCYFISLIYAFVALTRTSDLFSRVALHAAS |
Ga0310915_108781981 | 3300031573 | Soil | MPLLWLRFALCCYAVGLVYALVAMSRTSDLFSEIALHAASLGMVF |
Ga0307477_100975714 | 3300031753 | Hardwood Forest Soil | MSLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIALHAASLGMV |
Ga0307478_108561511 | 3300031823 | Hardwood Forest Soil | MSLLWLRFALACYFIGLVYAFVALRRTSDLFSRVAL |
Ga0307471_1001279661 | 3300032180 | Hardwood Forest Soil | MSLLWLRFALACYFIGLTYAFFALSRTSDLFSRIALHAASLGMVFH |
Ga0307471_1001679471 | 3300032180 | Hardwood Forest Soil | MSLLWLRFALGCYFVGLVYAFVALTRTSDLFSRIAL |
Ga0307471_1020383602 | 3300032180 | Hardwood Forest Soil | MPLHWLRFALGCYFVGLIYAFVALTRTSDLFSRVAFHAASLGMVF |
Ga0335082_102798773 | 3300032782 | Soil | MSLLWLRFALGCYFVGLVYAFVALTRTSETFSRIALHAASMGMV |
Ga0335082_113135361 | 3300032782 | Soil | LLWLRFALGCYFIGLIYAFVALTRTSDLFSRIALHAASLG |
Ga0335080_111518732 | 3300032828 | Soil | MPLLWLRFALGCYFIGLVYAFVALTRTSDLFSRIAFHAASM |
Ga0335081_100120901 | 3300032892 | Soil | MSLLWLRFALGCYFIGLVYAFVALSRTSDLFSRIALHA |
Ga0335081_107288473 | 3300032892 | Soil | MSLLWLRFALACYFIGLVYAFVALTRTSDLFSRIALHAATLGMVF |
Ga0335069_105109181 | 3300032893 | Soil | MPLLWLRFALACYLIGLIYAFVALNRASDLFSRIALHAAGLGLLF |
Ga0334804_089159_1_126 | 3300033818 | Soil | MALLWLRFALACYFIGLTYAFFALTRTSDLFSRIALHAASLG |
⦗Top⦘ |