NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metatranscriptome Family F102242

Metatranscriptome Family F102242

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102242
Family Type Metatranscriptome
Number of Sequences 101
Average Sequence Length 160 residues
Representative Sequence MKLAILFTLLAVGEASLLRRSDADPEGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCLPPLKKHKAEGACCFICK
Number of Associated Samples 73
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 4.95 %
% of genes near scaffold ends (potentially truncated) 68.32 %
% of genes from short scaffolds (< 2000 bps) 100.00 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.30

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (100.000 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(69.307 % of family members)
Environment Ontology (ENVO) Unclassified
(82.178 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(67.327 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 25.00%    β-sheet: 4.55%    Coil/Unstructured: 70.45%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.30
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300010981|Ga0138316_11252824All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300010985|Ga0138326_11227054All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300010987|Ga0138324_10580511All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300010987|Ga0138324_10618765All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata542Open in IMG/M
3300012413|Ga0138258_1468150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata518Open in IMG/M
3300012419|Ga0138260_10078335All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300012935|Ga0138257_1674150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata516Open in IMG/M
3300018755|Ga0192896_1068949All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300018768|Ga0193503_1061522All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300018800|Ga0193306_1062415All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300018806|Ga0192898_1081005All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300018823|Ga0193053_1078408All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300018825|Ga0193048_1064979All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300018836|Ga0192870_1085944All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300018846|Ga0193253_1140396All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata525Open in IMG/M
3300018870|Ga0193533_1126668All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata520Open in IMG/M
3300018879|Ga0193027_1109340All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300018889|Ga0192901_1117715All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300018922|Ga0193420_10095052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata538Open in IMG/M
3300021894|Ga0063099_1057092All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata558Open in IMG/M
3300021904|Ga0063131_1017026All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300021905|Ga0063088_1060277All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300021911|Ga0063106_1016552All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300021911|Ga0063106_1050942All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata620Open in IMG/M
3300021913|Ga0063104_1064361All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300021927|Ga0063103_1060219All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300021930|Ga0063145_1147685All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata514Open in IMG/M
3300021936|Ga0063092_1009149All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300021941|Ga0063102_1040004All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata548Open in IMG/M
3300021941|Ga0063102_1089958All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300021950|Ga0063101_1117208All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300028575|Ga0304731_10590812All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata561Open in IMG/M
3300028575|Ga0304731_10736779All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300030653|Ga0307402_10643349All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata617Open in IMG/M
3300030653|Ga0307402_10738368All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300030653|Ga0307402_10896424All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata517Open in IMG/M
3300030670|Ga0307401_10379298All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata642Open in IMG/M
3300030670|Ga0307401_10504476All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata551Open in IMG/M
3300030670|Ga0307401_10510020All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300030670|Ga0307401_10512997All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata546Open in IMG/M
3300030671|Ga0307403_10678150All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300030671|Ga0307403_10709684All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata547Open in IMG/M
3300030699|Ga0307398_10596541All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata611Open in IMG/M
3300030699|Ga0307398_10768214All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300030702|Ga0307399_10501079All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata595Open in IMG/M
3300030702|Ga0307399_10525030All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata582Open in IMG/M
3300030702|Ga0307399_10581290All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata553Open in IMG/M
3300030702|Ga0307399_10618124All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata536Open in IMG/M
3300030709|Ga0307400_10830670All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata569Open in IMG/M
3300030756|Ga0073968_11630604All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata731Open in IMG/M
3300030786|Ga0073966_11195876All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300030786|Ga0073966_11674193All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata669Open in IMG/M
3300030857|Ga0073981_11526269All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300030859|Ga0073963_10861756All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata586Open in IMG/M
3300030859|Ga0073963_10918646All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata541Open in IMG/M
3300030910|Ga0073956_10769216All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031062|Ga0073989_13266530All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata672Open in IMG/M
3300031063|Ga0073961_11758103All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata506Open in IMG/M
3300031459|Ga0073950_10704952All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata554Open in IMG/M
3300031459|Ga0073950_10901744All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata505Open in IMG/M
3300031522|Ga0307388_10969886All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300031522|Ga0307388_11148052All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300031522|Ga0307388_11219948All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300031579|Ga0308134_1161185All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata512Open in IMG/M
3300031674|Ga0307393_1123359All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata574Open in IMG/M
3300031674|Ga0307393_1130901All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata559Open in IMG/M
3300031710|Ga0307386_10664502All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300031717|Ga0307396_10571094All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031725|Ga0307381_10343070All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300031729|Ga0307391_10765669All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata552Open in IMG/M
3300031734|Ga0307397_10400189All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata634Open in IMG/M
3300031734|Ga0307397_10522462All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031735|Ga0307394_10428166All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300031735|Ga0307394_10477611All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata501Open in IMG/M
3300031737|Ga0307387_10785205All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata601Open in IMG/M
3300031737|Ga0307387_10960399All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata544Open in IMG/M
3300031737|Ga0307387_11006947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata531Open in IMG/M
3300031737|Ga0307387_11106572All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata507Open in IMG/M
3300031737|Ga0307387_11130644All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata502Open in IMG/M
3300031742|Ga0307395_10458720All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata556Open in IMG/M
3300031750|Ga0307389_10956059All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata567Open in IMG/M
3300031750|Ga0307389_10997978All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300031752|Ga0307404_10523257All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata500Open in IMG/M
3300032463|Ga0314684_10769498All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata550Open in IMG/M
3300032470|Ga0314670_10674695All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300032517|Ga0314688_10731043All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300032522|Ga0314677_10696947All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata530Open in IMG/M
3300032540|Ga0314682_10630599All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata585Open in IMG/M
3300032616|Ga0314671_10636364All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata575Open in IMG/M
3300032617|Ga0314683_10577911All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata694Open in IMG/M
3300032650|Ga0314673_10681686All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata528Open in IMG/M
3300032707|Ga0314687_10717545All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300032708|Ga0314669_10691145All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata560Open in IMG/M
3300032714|Ga0314686_10587235All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata543Open in IMG/M
3300032727|Ga0314693_10774047All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata513Open in IMG/M
3300032730|Ga0314699_10438920All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata588Open in IMG/M
3300032732|Ga0314711_10648792All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata532Open in IMG/M
3300032733|Ga0314714_10741066All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata534Open in IMG/M
3300032742|Ga0314710_10497633All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata503Open in IMG/M
3300033572|Ga0307390_10914671All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata555Open in IMG/M
3300033572|Ga0307390_10963752All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Choreotrichia → Choreotrichida → Strombidinopsidae → Strombidinopsis → Strombidinopsis acuminata540Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine69.31%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater15.84%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine11.88%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine2.97%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300010981Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 4)EnvironmentalOpen in IMG/M
3300010985Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 8)EnvironmentalOpen in IMG/M
3300010987Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome) (version 6)EnvironmentalOpen in IMG/M
3300012413Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA6.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012419Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Palmer Station, Antarctica after 24hr light incubation - RNA10.B_24.20151111 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012935Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA5.ICE_1m.20151110 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300018755Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000720 (ERX1789582-ERR1719407)EnvironmentalOpen in IMG/M
3300018768Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_138 - TARA_N000003011 (ERX1789448-ERR1719377)EnvironmentalOpen in IMG/M
3300018800Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_102 - TARA_N000001650 (ERX1789422-ERR1719172)EnvironmentalOpen in IMG/M
3300018806Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000722 (ERX1789621-ERR1719484)EnvironmentalOpen in IMG/M
3300018823Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002285 (ERX1789533-ERR1719243)EnvironmentalOpen in IMG/M
3300018825Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_081 - TARA_N000001436 (ERX1809755-ERR1740127)EnvironmentalOpen in IMG/M
3300018836Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_066 - TARA_N000000807 (ERX1789715-ERR1719504)EnvironmentalOpen in IMG/M
3300018846Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_092 - TARA_N000001299 (ERX1789404-ERR1719503)EnvironmentalOpen in IMG/M
3300018870Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002791 (ERX1789585-ERR1719426)EnvironmentalOpen in IMG/M
3300018879Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_152 - TARA_N000002480 (ERX1789365-ERR1719178)EnvironmentalOpen in IMG/M
3300018889Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_068 - TARA_N000000728 (ERX1789501-ERR1719269)EnvironmentalOpen in IMG/M
3300018922Metatranscriptome of marine eukaryotic protist communities collected during Tara Oceans survey from station TARA_128 - TARA_N000002289 (ERX1789394-ERR1719405)EnvironmentalOpen in IMG/M
3300021894Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-63M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021904Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S5 C1 B9 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021905Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-2S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021911Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-132S (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021913Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-130M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021927Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-122M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021930Metatranscriptome of Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Stratiphyt 2011 S29 C1 B24 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021936Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-15M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021941Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-120M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300021950Metatranscriptome of marine eukaryotic phytoplankton communities from the Arctic Ocean - ARK-118M (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300028575Metatranscriptome of Marine eukaryotic phytoplankton communities from the Antarctic Ocean - ANT-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030653Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-29 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030670Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-23 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030671Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-34 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030699Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-11 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030702Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-14 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030709Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-17 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030756Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030786Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_S_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030857Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S5_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030859Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_R_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030910Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_T_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031062Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_S21_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031063Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E6_Q_5 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031459Seawater microbial communities from Saanich Inlet, British Columbia, Canada - DeepDOM_E5_Q_0.2 metaT (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031522Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031579Metatranscriptome of marine microbial communities from Western Arctic Ocean, Canada - CB21_1120_Surface (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031674Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031710Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-2.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031717Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-6 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031725Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-1.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031729Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031734Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-7 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031735Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R2 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031737Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031742Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-5.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031750Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-3.R3 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031752Metatranscriptome of marine eukaryotic phytoplankton communities from Antarctic Ocean - PS103-59 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032463Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032470Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032517Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_24May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032522Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032540Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red3_26May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032616Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032617Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032650Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032707Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032708Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red2_22May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032714Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Red4_28May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032727Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim5_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032730Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Plim7_22May_deep (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032732Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032733Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Amb12_26May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300032742Metatranscriptome of seawater microbial communities from Espelandsvegen Fjord, Bergen, Norway - Shad11_24May_surf (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300033572Metatranscriptome of marine eukaryotic phytoplankton communities from South Atlantic Ocean ? PS103-4.R1 (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
Ga0138316_1125282413300010981MarineMKFATSAIIALALSALGEASLLRRSGGDPEAKLKEMEGKLVDCKAYNTPELCVKGERRARCEWLDMFKCSKIKTPPEPKPLTGPECEARSESSSHCTSGYGCMFDSITGKCHATPSICEQIECGEERNPPSPLQCLPPLKKHKADGACCFICK*
Ga0138326_1122705413300010985MarineVSVVSLLPSIAQRMKFATSAIIALALSALGEASLLRRSGGDPEAKLKEMEGKLVDCKAYNTPELCVKGERRARCEWLDMFKCSKIKTPPEPKPLTGPECEARSESSSHCTSGYGCMFDSITGKCHATPSICEQIECGEERNPPSPLQCLPPLKKHKADGACCFICK*
Ga0138324_1058051113300010987MarineFGSSILVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK*
Ga0138324_1061876513300010987MarineMKLASSVAALLAICVLGEATILRRSRGPTDDAIKKAEGGLVECKAYNTPELCVKGERRARCEYLDMFGCSEIKTPAEKPAPTGPECEARSESSDHCTKLWGCMFDTTTGQCHATPGICEQIECGEERNPPRPIECLPPLKKVKPEGSCCFICK*
Ga0138258_146815013300012413Polar MarineMKLTVATVCVLLALGEASVLRNGRGEPAGLKDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSEVKTPPEQAALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPAICDQIECGEERNPPRPLQCLPPMQKHKAEGACCFICK*
Ga0138260_1007833513300012419Polar MarineMKLTILFTLLAFGEASLLRRSGADPEGLKDMESKLVSCKSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKADGACCFICK*
Ga0138257_167415013300012935Polar MarineMKLTVATVCVLLALGEASVLRNGRGEPAGLKDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSELKTPPEQAALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPAICDQIECGEERNPPRPLQCLPPMQKHKAEGACCFICK*
Ga0192896_106894913300018755MarineSIVVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193503_106152213300018768MarineSSILVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193306_106241513300018800MarineQRKSQQHLAVECVRSFPPQSRMKLAVAAFVALLAVGEGSVLRQSRMQADPKGLKEMEGKLVSCKTYNTPELCEKGERRSRCEWLDMFKCSDRKTPPEPKPLTGPECEARSESSDFCTAGLGCMFDSITGQCHATPGVCELIKCGEERNPPQPIECMPPFKKHKAEGACCFICKHEDSK
Ga0192898_108100513300018806MarineGSSILVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193053_107840813300018823MarineLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193048_106497923300018825MarineGSSILVLEPVLSDPPSAIACRRMKFALVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0192870_108594413300018836MarineLVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193253_114039613300018846MarineMKFGAIFAVLALADAAVLRGDPAGLKSMEDGLVSCKAYNSPELCVKGERRARCEWLDMFKCTELKEQPEQQALTGPECEARSSSFDHCTAGLGCMFDTTTGQCHATPAICDLVKCGEERSPPQPVRCLPPLKKHKADGACCFICK
Ga0193533_112666813300018870MarineVLEPVLSDPPSAIACRRMKFALVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193027_110934013300018879MarineILVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0192901_111771513300018889MarineSSIVVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0193420_1009505213300018922MarineFGSSILVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0063099_105709213300021894MarineNHSDLELLIALPSNYYRLHKRMKSAAIVLALLALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0063131_101702613300021904MarineSILVLEPVLSDPPSAIACRRMKFAVVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0063088_106027713300021905MarineVAQVHSEKYHATPPGSRRPNQLRMKLAILFTLLAVGEASLLRRSDADPKGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCFPPLKKHKAEGACCFICK
Ga0063106_101655213300021911MarineIALPSNYYRLHKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSNHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0063106_105094213300021911MarineLKHKRLKYQRLTSVKGLNSTKSLMKFAVASALILLALGEASVLSRSRVAGAPAATKALEGELVECPSYPTPETCVKGDRRARCEWLDMYKCSKIETPPEPEALSGPECEARAESSDFCTLGLGCLFDSITGKCHATPSICSQIECAEERSPPAPLRCLPPLKKHKADGACCFICK
Ga0063104_106436113300021913MarineAQVQPEKYHATPPGSRRPNQLRMKLAILFTLLAVGEASLLRRSDADPKGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCLPPLKKHKAEGACCFICK
Ga0063103_106021913300021927MarineVHSEKYHATPPGSRRPNQLRMKLAILFTLLAVGEASLLRRSDADPKGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCFPPLKKHKAEGACCFICK
Ga0063145_114768513300021930MarineVLSDPPSAIACRRMKFALVLALFSLGDATLLRRSGEDPEAKLKAMEGKLVECKAYNTPELCVKGERRARCEYLDMFGCSELKGTPEPKPPTGPECEARSASSNECTALYGCMFDSITGQCHATPGICEQIECGEERNPPSPIQCLPPLKKHKPEGSCCFICK
Ga0063092_100914913300021936MarineQVVQNHSDLELLIALPSNYYRLHKRMKSAAIVLALLALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0063102_104000413300021941MarineRPCVAQVHSEKYHATPPGSRRPNQLRMKLAILFTLLAVGEASLLRRSDADPKGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCFPPLKKHKAEGACCFICK
Ga0063102_108995813300021941MarineLTHPLIEELLPTTSKMKFAVATVVMLLAPADASLLRGDPAGMKTLEGSLVACKSYNTAELCTKGERRSRCEWLDMFDCQERKTPPEPETLTDAECAARGETSDFCTLGLGCMFDSITGKCHATPSICSQIECGEERNPPSPVRCLPPLKKHKADGACCFICK
Ga0063101_111720813300021950MarineVAQVQPEKYHATPPGSRRPNQLRMKLAILFTLLAVGEASLLRRSDADPKGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCFPPLKKHKAEGACCFICK
Ga0304731_1059081213300028575MarineMKFASAVVTLLVLFVFGDASVLRRSRVDGDPKGLAEMEGKLVDCKAYNTPELCVKGERRARCEWLDMFKCSKLKEAPAPKDPTGPECEARSDSSDHCTALLGCMFDSITGQCHATPAVCDLIECGEERNPPRPIECLPPLKKHKAEGACCFICK
Ga0304731_1073677913300028575MarineMKFATSAIIALALSALGEASLLRRSGGDPEAKLKEMEGKLVDCKAYNTPELCVKGERRARCEWLDMFKCSKIKTPPEPKPLTGPECEARSESSSHCTSGYGCMFDSITGKCHATPSICEQIECGEERNPPSPLQCLPPLKKHKADGACCFICK
Ga0307402_1064334913300030653MarineLKTFCGSSVEATVPQSLQRMKLMYSVATVLALSTLGEASLLRRSFQDADPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTLKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHKADGACCFICK
Ga0307402_1073836813300030653MarineVEADPKGLKEAESKLVSCTAYNTPELCVKGERRARCEWLDMFKCKARETPPEPKALTGPECEARSDSSDHCTAGLGCMFDSITGQCHATPGICEQIECGEERNPPRPIECLPPLKKHKADGACCFICK
Ga0307402_1089642413300030653MarineVESGCRLLTHPLIEELLPTISKMKFAVATVVMLLAPADASLLRGGPAGMKELEGSLVACKSYNTAELCTKGERRSRCEWLDMFDCQERKTPPEPETLTDAECAARGETSDFCTLGMGCMFDSITGKCHATPSICSQIECGEERNPPSPVRCLPPLKKHKADGACCFICK
Ga0307401_1037929813300030670MarineFCGSSVEATVPQSLQRMKLMYSVATVLALSTLGEASLLRRSFQDADPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTLKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHKADGACCFICK
Ga0307401_1050447613300030670MarineEFESVACVPAAGKNCSGMKMTVAALFLLFALGEASLLRRSSEDPAGMKEMESKLVDCKSYNTPELCVKGERSARCEWLDMFKCSTLEKKPEKAVLTGPECEARSESHDKCVSGWHCMFDTTTGQCHATPSICAQIECGEERNPPQPVQCLPPLKKTKPEGSCCFICK
Ga0307401_1051002013300030670MarineMRVAIFVTVLALGEASVLRRSRVEGDPKGMADMESKLVACKSYNTPEICIKGERRARCEWLDMFKCKARETPPEPKALTGPECEARSDSSDHCTAGLGCMFDSITGQCHATPGICEQIECGEERNPPRPIECLPPLKKHKADGACCFICK
Ga0307401_1051299723300030670MarineMKLTILFTLLALGEASLLRRSGGDPEGLSDMESKLVSCKSYNTPEVCVKGERRARCEWLDMFKCQERKTPPEPEALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKADGACCFICK
Ga0307403_1067815013300030671MarineMKLTILFTLLAFGEASLLRRSGADPEGLKAMESKRATCQSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKADGACCFICK
Ga0307403_1070968413300030671MarineMKFGGVTIFVVLALADAAVLRGDPAGLKAAEAGLVSCKSYNSPELCVKGERRARCEWLDMFKCTALKEQPEAVALTGPECEARSSSFDHCTGGLGCMFDTTTGQCHATPAICDLVKCGEERSPPQPVRCLPPLKKHKADGACCFICK
Ga0307398_1059654113300030699MarineMKLTILFTLLALGEASLLRRSDADTKAALASDPTDAKLAEMEGKLVSCKSYNTPEVCVKGERRARCEWLDMFKCQERKTPPEPEALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPLQCHPPLKKHKAEGACCFICK
Ga0307398_1076821413300030699MarineQVSFCAEHRPNQSRMKLTVATVFALLALGDASVLRRSRMEGEPAGLKDMENQLVSCKSYNTPELCVKGERRSRCEWLDMFKCSDRKEAPEAQALTGPECEARSESSDFCTAAHNCMFDSMTGQCHATPSICEQIECGEERGQPVRCLPPLKKHKADGACCFICK
Ga0307399_1050107913300030702MarineLKWLESTQISNYRLLSRAITTGYKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSNHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0307399_1052503013300030702MarineMKLTILFTLLALGEASLLRRSDADTKAALASDPTDAKLAEMEGKLVSCKSYNTPEVCVKGERRARCEWLDMFKCQERKTPPEPEALTGPECEARSDTSDHCTAGLGCMFDSITGQCHATPGICEQIECGEERNPPQPLQCHPPLKKHKAEGACCFICK
Ga0307399_1058129013300030702MarineMKLTVATLVLLLALGEASLLQRSRTGAAPEDTAKLEASLVACESYNTPELCVKGQRRARCEWLDMFKCKERETPPEPKALTGPECEARGESSDFCTLGLGCMFDSTTGKCHATPSICSQIECGEERANPQPLQCLPPLKKTKPDGACCFICK
Ga0307399_1061812413300030702MarineMKLTILFALLALGEASLLRRSGADPEGLSDMEGQLVSCKSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPQALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPGICEQIECGEEQNPPQPLVCFPPLKKHKAEGACCFICK
Ga0307400_1083067013300030709MarineMKLAILFTLLAVGEASLLRRSDADPEGLSDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIQCLPPLKKHKAEGACCFICK
Ga0073968_1163060413300030756MarineMKLAPSVASLLAFFALGDASLLRRSEPEADEPAGLKEMEGKLVDCKAYNTAELCEKGERRARCEWLEMFKCSTREAPPPPEPLTGPECEARSSSMNHCQSGFHCVFDTITGKCHAAPAICDQIECGEERNPPQPLQCLPPLKKTKPEGSCCFICTSPKEAKKEEKKAEKKAEEEILK
Ga0073966_1119587613300030786MarineMKIAAASILALFAVGDASILRRSRGEPAGLKDMEGKLVSCKSYNTPELCEKGERRARCEWLDMFKCSDRETPPEPKALTGPECEARSDSSDHCTAGVGCMFDSITGKCHATPSICEQIECGEERSPPQPLQCLPPLKKHKADGACCFICK
Ga0073966_1167419313300030786MarineQASAALSKAQQRVASERVRSSTPQSRMKFAVAAFVACLAIGEGSVLRRSRMQADPKGLKDMEGKLVSCKSYNTPELCVKGERRSRCEWLDMFKCSDRKTPPEPKPLTGPECEARSESSDFCTAGLGCMFDSITGQCHATPSICEQIECGEERNPPQPLQCLPPLKKTKPEGSCFFICTSPKEAKKEEKKAEKKAEEEILK
Ga0073981_1152626913300030857MarineMKLAVAAFVALLAVGEGSVLRQSRMQADPKGLKEMEGKLVSCKTYNTPELCEKGERRSRCEWLDMFKCSELKEPPEQKPLTGPECEARSESSSHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPAPLQCLPPLKKHKADGACCFICK
Ga0073963_1086175613300030859MarineMKLAPSVASLLAFFALGDASLLRRSEPEADEPAGLKEMEGKLVDCKAYNTAELCEKGERRARCEWLEMFKCSTREAPPPPEPLTGPECEARSSSMNHCQSGFHCVFDTITGKCHAAPAICDQIECGEERNPPQPLQCLPPLKKTKPEGSCCFICTSPKEAKKEEKKAEKKAE
Ga0073963_1091864613300030859MarineAALSKAQQRVVSECVRSFPPQSRMKFAVAAFVACLALGEGSVLRRSRMQADPKGLKEMEGKLVSCKSYNTPELCEKGERRSRCEWLDMFKCSDRKTPPEPKPLTGPECEARSESSDFCTAGLGCMFDSITGQCHATPTICEQIECGEERNPPQPIQCLPPLKKHKAEGACCFICK
Ga0073956_1076921613300030910MarineMKFATYVASILSLCVLADAATVLRRGRADPEGMKDMENSLVSCKSYNTPELCEKGERRARCEWLDMFKCSERKAAPEPEPPTGPECEARSESSSHCTALFGCMFDSITGQCHATPAICDQIECGEERNPPQPIQCLPPLKKHKAEGACCFICK
Ga0073989_1326653013300031062MarineMKFASSVVTVLALVALGEAVLRKSRTGDDPKGLKELEGSLVSCKSYNTPELCVKGERRARCEWLDMFKCSELKEPPEQKPLTGPECEARSESSSHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPAPLQCLPPLKKHKADGACCFICK
Ga0073961_1175810313300031063MarineMACTVAAFLALFVLGEASVLRRSRQEGAPEDKIKEMEKKLVGCASYNTPELCEKGERRARCEWLDMFKCSERKAPPEPEPLTGPECEARSDSFDHCTSGYGCMFDSITGKCHATPGICEQIECGEERNPPQPIQCLPPLKKHKADG
Ga0073950_1070495213300031459MarineAQRKSQQHLAVECVRSFPPQSRMKLAVAAFVAILAVGEGSVLRQSRMQADPKGLKEMEGKLVSCKTYNTPELCEKGERRSRCEWLDMFKCSDRKTPPEPKPLTGPECEARSESSDFCTAGLGCMFDSITGQCHATPGVCELIKCGEERNPPQPIECMPPFKKHKAEGACCFICKHEDSK
Ga0073950_1090174413300031459MarineMKFATYVASILSLCVLADAATVLRRGRADPEGMKDMENSLVSCKSYNTPELCEKGERRARCEWLDMFKCSERKAAPEPEPPTGPECEARSESSSHCTALFGCMFDSITGQCHATPAICDQIECGEERNPPQPIQCLPPLKKHK
Ga0307388_1096988613300031522MarineLKRLEATEFESVACVPAAGKNCSGMKMTVAALFMLFALGEASLLRRSSEDPAGMKEMESKLVDCKSYNTPELCVKGERSARCEWLDMFKCSTLEKKPEKAVLTGPECEARSESHDKCVSGWHCMFDTTTGQCHATPSICAQIECGEERNPPQPVQCLPPLKKTKPEGSCCFICK
Ga0307388_1114805213300031522MarineMKLTVATVCVLLALGEASVLRNGRGEPAGLKDMESKLVSCKSYNTPELCVKGERRARCEWLDMFKCSELKTPPEQAALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPAICDQIECGEERNPPRPLQCLPPMQKHKAEGACCFICK
Ga0307388_1121994813300031522MarineGIISFHSLFPPHPLPLLSTKDENKLNSLTMYSVATVLALSTLGEASLLRRSFQDADPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTIKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHK
Ga0308134_116118513300031579MarineKSHLAFLSASLVRMKFTSLLLLLALSVGEAAVLRRSFVKKGPIDAMEAGLVACKSYSTPETCVKGERRARCEWLDMFKCSEMTTKPEPKALEDYECELRSDSSDHCTSGMGCMFDSITGQCHATPGICEQIKCGEERNPPQPVQCLPPLKKHKADGACCFICK
Ga0307393_112335913300031674MarineFCGSSSVEATVPQSLQRMKLMYSVATVLALSTLGEASLLRRSFQDAAPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTLKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHKADGACCFICK
Ga0307393_113090113300031674MarineMKFAIATLMMLLAPGDASLLRSSAPTLACKQYSTAELCVKGERRSKCEWLDMFDCQERKTPPEPETLTDAECAARTETSDFCTLGMGCMFDSITGSCHATPSICSQIECGEERNPPVPVRCLPPLKKHKAEGACCFICK
Ga0307386_1066450213300031710MarineMKFGGVTIFVALALADAAVLRGDPAGLKDMEKGLVSCKSYNSPELCVKGERRARCEWLDMFKCTALKEQPEAVALTGPECEARSSSFDHCTGGLGCMFDTTTGQCHATPAICDLVKCGEERSPPQPVRCLPPLKKHKADGACCFICK
Ga0307396_1057109413300031717MarineAEHFPNQSRMKLAIATVFALLALGDASVLRRSRMEGEPAGLKDMENQLVSCKSYNTPELCVKGERRSRCEWLDMFKCSDRKEAPEAQALTGPECEARSESSDFCTAAHNCMFDSMTGQCVATPSICEQIECGEERGQPVRCLPPLKKHKADGACCFICK
Ga0307381_1034307013300031725MarineMKLTVASLVLLLALGEASLLKRSRTGSDPAVDKLEGSLVACESYNTPEICVKGERRARCEWLDMFKCKKRETPPEPKALTGPECEARGESSDFCTLGLGCMFDSITGKCHATPSICSQIECGEERANPQPLQCLPPLKKTKPDGACCFICK
Ga0307391_1076566913300031729MarineMKLTILFTLLALGEASLLRRSDADTKAALASDPTDAKLAEMEGKLVSCKSYNTPEVCVKGERRARCEWLDMFKCQERKTPPEPEALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKADGACCFICK
Ga0307397_1040018913300031734MarineLLRRSDADTKAALASDPTDAKLAEMEGKLVACKSYNTPEVCVKGERRARCEWLDMFKCQERKTPPEPEALTGPECEARSDTSDHCTAGLGCMFDSITGQCHATPGICEQIECGEERNPPQPLQCHPPLKKHKAEGACCFICK
Ga0307397_1052246213300031734MarineMKLTVATLVLLLALGEASLLKRSRTGADPAVDKLEGSLVACESYNTPEICVKGERRARCEWLDMFKCKKREAAPEPKALTGPECEARGRSSDFCTLGLGCMFDSITGKCHATPSICSQIECGEERANPQPLQCLPPLKKTKPDGACCFICK
Ga0307394_1042816613300031735MarineKTFCGSSVEATVPQSLQRMKLMYSVATVLALSTLGEASLLRRSFQDADPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTLKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHKADGACCFICK
Ga0307394_1047761113300031735MarineMKLTILFTLLAFGEASLLRRSGADPEGLKDMESKLVSCKSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKAD
Ga0307387_1078520513300031737MarineVEATVPQSFQRMKLMYSVATVLALSTLGEASLLRRSFQDADPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTIKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHKPDGACCFICK
Ga0307387_1096039913300031737MarineMKLIVATLLTLLALGDASVLRRSRAAADPAVAGLVECTSYSTKDLCLKGERRARCEWLDQFDCQKRETPPEPEPLTGPECEARTESSNFCTLGLGCMFDSMTGKCYATPSICSQIECAEERNPPSPLKCLPPLKKHKADGACCFICK
Ga0307387_1100694713300031737MarineRKVAFQKVQRMKIAHSIAAVLALLPLAEASLIKRSFLVADPKGLAEAEAKLVSCKAYNTPELCVKGERRARCEWLDMFKCSTLKTPPEQKDPTGPECEARSDSSDHCTGLLGCMFDSTTGQCHATPAICDLIECGEERNPPAPVQCLPPLKKHKADGACCFICK
Ga0307387_1110657213300031737MarineMKLTILFTLLALGEASLLRRSGGDPEGLSDMEGKLVACKSYNTAELCVKGERRARCEWLDMFDCQERKTPPEPEALTGPECEARSDTSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPLQCHPPLKKHKAE
Ga0307387_1113064413300031737MarineFWLKRLEATEFESVACVPAAGKNCSGMKMTVAALFMLFALGEASLLRRSSEDPAGMKEMESKLVDCKSYNTPELCVKGERSARCEWLDMFKCSTLEKKPEKAVLTGPECEARSESHDKCVSGWHCMFDTTTGQCHATPSICAQIECGEERNPPQPVQCLPPLKKTKP
Ga0307395_1045872013300031742MarineMKLTILFALLALGEASLLRRSGADPEGLSDMESKLVACKSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECLPPLKKHKAEGACCFICK
Ga0307389_1095605913300031750MarineQRMKLMYSVATVLALSTLGEASLLRRSFQDADPKGLAEAESKLVACKAYNTPELCVKGERRARCEWLDMFKCSTLKTPPEQQAPTGPECEARSDSSDHCTGLFGCMFDSITGQCHATPAICDQIQCGEERNPPAPLQCVPPLKKHKPDGACCFICK
Ga0307389_1099797813300031750MarineMKLTILFTLLACGDASLLRRSGADPEGLKDMESKLVSCKSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPEALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKADGACCFICK
Ga0307404_1052325713300031752MarineMKLTILFTLLACGDASLLRRSGADPEGLKDMESKLVSCKSYNTPELCVKGQRRARCEWLDMFKCSERKTPPEPQALTGPECEARGDSSDHCTSGLGCMFDSITGQCHATPGICEQIECGEERNPPQPIECFPPLKKHKAD
Ga0314684_1076949813300032463SeawaterMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0314670_1067469513300032470SeawaterMKFGAIFVVLALADAAVLRGDPAGLKSMEDGLVSCKAYNSPELCVKGERRARCEWLDMFKCTELKEQPEQKALTGPECEARSSSFDHCTAGLGCMFDTTTGQCHATPAICDLVKCGEERSPPQPVRCLPPLKKHKADGACCFICK
Ga0314688_1073104313300032517SeawaterQVDCTRKSHLAFPSASLVRMKFTSLLLLLALSVGEAAVLRRSFVKKGPIDAMEAGLVACKSYSTPETCVKGERRARCEWLDMFKCSEMTTKPEPKALEDYECELRSDSSDHCTSGMGCMFDSITGQCHATPGICEQIKCGEERNPPQPVECLPPLKKHKADGACCFICK
Ga0314677_1069694713300032522SeawaterRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0314682_1063059913300032540SeawaterHKRLKYQRLTSVKGLHSTKSLMKFAVASALTLLALGEASVLSRSRVAGAPAATKALEGELVECPSYPTPETCVKGDRRARCEWLDMYKCSKIETPPEPKALSGPECEARAESSDFCTLGLGCLFDSITGKCHATPSICSQIECAEERSPPAPLRCLPPLKKHKADGACCFICK
Ga0314671_1063636413300032616SeawaterQNHSDLELLIALPSNYSRLHKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTAGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0314683_1057791123300032617SeawaterTIQCWSSVCSTTWLRLLCHHEYLPHPQHKRLKYQWLTSVKGLNSTKSLMKFAVASALTLLALGEASVLSRSRVAGAPAATKALEGELVECPSYPTPETCVKGDRRARCEWLDMYKCSKIETPPEPKALSGPECEARAESSDFCTLGLGCLFDSITGKCHATPSICSQIECAEERSPPAPLRCLPPLKKHKADGACCFICK
Ga0314673_1068168613300032650SeawaterMKFGGVTIFVALALADAAVLRGDPAGLKDMEDGLVSCKAYNSPELCVKGERRARCEWLDMFKCTELKEQPEQKALTGPECEARSSSFDHCTAGLGCMFDTTTGQCHATPAICDLVKCGEERSPPQPVRCLPPLKKHKADGACCFICK
Ga0314687_1071754513300032707SeawaterVEADPKGLKEAESKLVSCTAYNTPELCVKGERRARCEWLDMFKSKARETPPEPKALTGPECEARSDSSDHCTAGMGCMFDSITGKCHATPGICEQIECGEERNPPRPIECLPPLKKHKADGACCFICK
Ga0314669_1069114513300032708SeawaterNHSDLELLIALPSNCYRLHKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTSGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0314686_1058723523300032714SeawaterSDRCLYLFTQQHAWTMKLNVLVCTLCVLRAASILSKSKGPAEDKLKAMEGKLVDCKAYNTKELCVKGERRARCEWLDMFKCSNRKTPPEPKPLTGPECEARSDSSDHCTSGYGCMFDSITGKCHATPGICEQIECGEERNPPQPIQCLPPLKKHKAEGACCFICK
Ga0314693_1077404713300032727SeawaterMKFTSLLLLLALSVGEAAVLRRSFVKKGPIDAMEAGLVACKSYSTPETCVKGERRARCEWLDMFKCSEMTTKPEPKALEDYECELLSDSSDHCTSGMGCMFDSITGQCHATPGICEQIKCGEERSPPQPVQCLPPLKKHKADGACCFIC
Ga0314699_1043892013300032730SeawaterQNHSDLELLIALPSNYYRLHKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTSGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0314711_1064879213300032732SeawaterMKFGAIFVVLALADAAVLRGDPAGLKSMEDGLVSCKAYNSPELCVKGERRARCEWLDMFKCTELKEQPEQKALTGPECEARSSSFDHCTAGIGCMFDTTTGQCHATPAICDLVKCGEERSPPQPVRCLPPLKKHKADGACCFICK
Ga0314714_1074106613300032733SeawaterQVVQNHSDLELLIALPSNYYRLRKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTSGLGCLFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKADGACCFICK
Ga0314710_1049763313300032742SeawaterQVVQNHSDLELLIALPSNCYRLHKRMKSAAIVLALFALGEASVLRQSRINADPKGLKEMEGKLVSCKAYNTPELCVKGDRRARCEWLDMFKCSELKEAAEPQALTGPECEARSDSSDHCTAGLGCMFDSISGQCHATPTICEQIECGEERNPPSPIQCLPPLKKHKA
Ga0307390_1091467113300033572MarineTEFESVACVPAAGKNCSGMKMTVAALFMLFALGEASLLRRSSEDPAGMKEMESKLVDCKSYNTPELCVKGERSARCEWLDMFKCSTLEKKPEKAVLTGPECEARSESHDKCVSGWHCMFDTTTGQCHATPSICAQIECGEERNPPQPVQCLPPLKKTKPEGSCCFICK
Ga0307390_1096375213300033572MarineHCLCGSKQHQVSFCAEHHPNQSRMKLTVATVFALLALGDASVLRRSRMEGEPAGLKDMENQLVSCKSYNTPELCVKGERRSRCEWLDMFKCSDRKEAPEAQALTGPECEARSESSDFCTAAHNCMFDSMTGKCHATPTICSQIECGEERGQPVRCLPPLKKHKADGACCFICK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.