NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102383

Metagenome / Metatranscriptome Family F102383

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102383
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 55 residues
Representative Sequence CKVDINPEGKISELETGVQLCEAVPWSQFRYQPPVQGGHPVKVKTEVEVRFEPRK
Number of Associated Samples 85
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 2.97 %
% of genes near scaffold ends (potentially truncated) 94.06 %
% of genes from short scaffolds (< 2000 bps) 94.06 %
Associated GOLD sequencing projects 78
AlphaFold2 3D model prediction Yes
3D model pTM-score0.56

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.119 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil
(10.891 % of family members)
Environment Ontology (ENVO) Unclassified
(33.663 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(42.574 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 8.43%    β-sheet: 19.28%    Coil/Unstructured: 72.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.56
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF14403CP_ATPgrasp_2 2.97
PF03372Exo_endo_phos 1.98
PF01261AP_endonuc_2 1.98
PF02321OEP 1.98
PF00069Pkinase 1.98
PF12704MacB_PCD 1.98
PF00072Response_reg 0.99
PF07635PSCyt1 0.99
PF03551PadR 0.99
PF02239Cytochrom_D1 0.99
PF07228SpoIIE 0.99
PF13801Metal_resist 0.99
PF13646HEAT_2 0.99
PF00892EamA 0.99
PF01658Inos-1-P_synth 0.99
PF03054tRNA_Me_trans 0.99
PF02801Ketoacyl-synt_C 0.99
PF13620CarboxypepD_reg 0.99
PF01339CheB_methylest 0.99
PF14052Caps_assemb_Wzi 0.99
PF08818DUF1801 0.99
PF03544TonB_C 0.99
PF00392GntR 0.99
PF01431Peptidase_M13 0.99
PF04337DUF480 0.99
PF14300DUF4375 0.99
PF03965Penicillinase_R 0.99
PF13541ChlI 0.99
PF03631Virul_fac_BrkB 0.99
PF04174CP_ATPgrasp_1 0.99
PF14534DUF4440 0.99
PF07687M20_dimer 0.99
PF02357NusG 0.99
PF01610DDE_Tnp_ISL3 0.99
PF00753Lactamase_B 0.99
PF08241Methyltransf_11 0.99
PF07883Cupin_2 0.99
PF03786UxuA 0.99
PF04397LytTR 0.99
PF07994NAD_binding_5 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 7.92
COG1538Outer membrane protein TolCCell wall/membrane/envelope biogenesis [M] 3.96
COG1260Myo-inositol-1-phosphate synthaseLipid transport and metabolism [I] 1.98
COG1846DNA-binding transcriptional regulator, MarR familyTranscription [K] 1.98
COG2201Chemotaxis response regulator CheB, contains REC and protein-glutamate methylesterase domainsSignal transduction mechanisms [T] 1.98
COG0250Transcription termination/antitermination protein NusGTranscription [K] 0.99
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 0.99
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 0.99
COG1295Uncharacterized membrane protein, BrkB/YihY/UPF0761 family (not an RNase)Function unknown [S] 0.99
COG1312D-mannonate dehydrataseCarbohydrate transport and metabolism [G] 0.99
COG1695DNA-binding transcriptional regulator, PadR familyTranscription [K] 0.99
COG1733DNA-binding transcriptional regulator, HxlR familyTranscription [K] 0.99
COG2308Circularly permuted ATP-grasp proteinGeneral function prediction only [R] 0.99
COG3132Uncharacterized conserved protein YceH, UPF0502 familyFunction unknown [S] 0.99
COG3464TransposaseMobilome: prophages, transposons [X] 0.99
COG3590Predicted metalloendopeptidasePosttranslational modification, protein turnover, chaperones [O] 0.99
COG3682Transcriptional regulator, CopY/TcrY familyTranscription [K] 0.99
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 0.99
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 0.99
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.12 %
UnclassifiedrootN/A11.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918008|ConsensusfromContig146732All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium988Open in IMG/M
3300004082|Ga0062384_101112177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia570Open in IMG/M
3300005533|Ga0070734_10102348All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1681Open in IMG/M
3300005591|Ga0070761_10569600All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076703Open in IMG/M
3300005712|Ga0070764_11026752Not Available521Open in IMG/M
3300006162|Ga0075030_100682977All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia813Open in IMG/M
3300009177|Ga0105248_12856264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia551Open in IMG/M
3300009545|Ga0105237_11082847All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium808Open in IMG/M
3300009636|Ga0116112_1096738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6835Open in IMG/M
3300009637|Ga0116118_1134915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia806Open in IMG/M
3300009639|Ga0116122_1053877All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300009839|Ga0116223_10679988All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300010341|Ga0074045_11051667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia510Open in IMG/M
3300010379|Ga0136449_100423874All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60762348Open in IMG/M
3300010379|Ga0136449_100608038All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1861Open in IMG/M
3300010379|Ga0136449_102172980All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia811Open in IMG/M
3300010379|Ga0136449_102619858All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae719Open in IMG/M
3300010379|Ga0136449_102954569All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium665Open in IMG/M
3300012683|Ga0137398_11078844All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia554Open in IMG/M
3300013308|Ga0157375_13212443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Roseomonas → Roseomonas terrae545Open in IMG/M
3300014160|Ga0181517_10161590All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1250Open in IMG/M
3300014161|Ga0181529_10479886All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4661Open in IMG/M
3300014162|Ga0181538_10182892All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300014165|Ga0181523_10286363All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia933Open in IMG/M
3300014167|Ga0181528_10753963All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia545Open in IMG/M
3300014168|Ga0181534_10153145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1183Open in IMG/M
3300014496|Ga0182011_10250735All Organisms → cellular organisms → Bacteria → Acidobacteria1188Open in IMG/M
3300014496|Ga0182011_10484378Not Available797Open in IMG/M
3300014501|Ga0182024_11020597All Organisms → cellular organisms → Bacteria → Acidobacteria985Open in IMG/M
3300014502|Ga0182021_10371786All Organisms → cellular organisms → Bacteria → Acidobacteria1692Open in IMG/M
3300014502|Ga0182021_11787978All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4740Open in IMG/M
3300014502|Ga0182021_11798017Not Available738Open in IMG/M
3300014502|Ga0182021_11847946All Organisms → cellular organisms → Bacteria → Acidobacteria727Open in IMG/M
3300014502|Ga0182021_13025954All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia563Open in IMG/M
3300014839|Ga0182027_10449114All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales1420Open in IMG/M
3300014839|Ga0182027_11843439Not Available584Open in IMG/M
3300017931|Ga0187877_1206599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia769Open in IMG/M
3300017931|Ga0187877_1272302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia650Open in IMG/M
3300017948|Ga0187847_10786331All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia538Open in IMG/M
3300017948|Ga0187847_10835599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia523Open in IMG/M
3300017973|Ga0187780_10170380All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1513Open in IMG/M
3300018017|Ga0187872_10244467All Organisms → cellular organisms → Bacteria806Open in IMG/M
3300018023|Ga0187889_10067923All Organisms → cellular organisms → Bacteria1842Open in IMG/M
3300018024|Ga0187881_10404635All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia559Open in IMG/M
3300018030|Ga0187869_10163604All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia1099Open in IMG/M
3300018042|Ga0187871_10266275All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia950Open in IMG/M
3300018058|Ga0187766_11457921All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia504Open in IMG/M
3300019242|Ga0181502_1110327Not Available636Open in IMG/M
3300019788|Ga0182028_1451766All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia803Open in IMG/M
3300021407|Ga0210383_10558108All Organisms → cellular organisms → Bacteria988Open in IMG/M
3300021476|Ga0187846_10075137All Organisms → cellular organisms → Bacteria1472Open in IMG/M
3300021860|Ga0213851_1001838All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3654Open in IMG/M
3300023101|Ga0224557_1052657Not Available1874Open in IMG/M
3300027570|Ga0208043_1050709All Organisms → cellular organisms → Bacteria1215Open in IMG/M
3300027725|Ga0209178_1413150All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia514Open in IMG/M
3300027826|Ga0209060_10429120All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia601Open in IMG/M
3300027853|Ga0209274_10190843All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin60761041Open in IMG/M
3300027879|Ga0209169_10662596Not Available543Open in IMG/M
3300027911|Ga0209698_11217184All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia554Open in IMG/M
(restricted) 3300028571|Ga0247844_1297002All Organisms → cellular organisms → Bacteria552Open in IMG/M
3300028779|Ga0302266_10354644All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia529Open in IMG/M
3300028785|Ga0302201_10035839All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2594Open in IMG/M
3300028882|Ga0302154_10145924Not Available1238Open in IMG/M
3300029817|Ga0247275_1122996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia670Open in IMG/M
3300029907|Ga0311329_10527915All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria796Open in IMG/M
3300029911|Ga0311361_10083270All Organisms → cellular organisms → Bacteria → Acidobacteria4712Open in IMG/M
3300029911|Ga0311361_10705239All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Oscillatoriophycideae → Oscillatoriales → Oscillatoriaceae → Okeania → unclassified Okeania → Okeania sp. SIO2F4923Open in IMG/M
3300029951|Ga0311371_10844749Not Available1119Open in IMG/M
3300029987|Ga0311334_11968314Not Available501Open in IMG/M
3300030225|Ga0302196_10318121All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia701Open in IMG/M
3300030524|Ga0311357_10291100All Organisms → cellular organisms → Bacteria1568Open in IMG/M
3300030659|Ga0316363_10341773All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4591Open in IMG/M
3300031236|Ga0302324_100113587All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales4544Open in IMG/M
3300031242|Ga0265329_10195100All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia665Open in IMG/M
3300031250|Ga0265331_10402377All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia614Open in IMG/M
3300031344|Ga0265316_10729205All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia698Open in IMG/M
3300031712|Ga0265342_10232181All Organisms → cellular organisms → Bacteria990Open in IMG/M
3300031718|Ga0307474_10916865All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300031726|Ga0302321_102478095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia605Open in IMG/M
3300031885|Ga0315285_10635860All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia700Open in IMG/M
3300031946|Ga0310910_11294580All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia563Open in IMG/M
3300032046|Ga0315289_10189717All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2260Open in IMG/M
3300032046|Ga0315289_10371893All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1437Open in IMG/M
3300032160|Ga0311301_10697613All Organisms → cellular organisms → Bacteria1428Open in IMG/M
3300032160|Ga0311301_12692232All Organisms → cellular organisms → Bacteria → Acidobacteria548Open in IMG/M
3300032261|Ga0306920_101539691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae948Open in IMG/M
3300032770|Ga0335085_11014036All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia896Open in IMG/M
3300032782|Ga0335082_10149570All Organisms → cellular organisms → Bacteria2262Open in IMG/M
3300032782|Ga0335082_11328544All Organisms → cellular organisms → Bacteria588Open in IMG/M
3300032783|Ga0335079_11805559All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia595Open in IMG/M
3300032892|Ga0335081_12708863All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300032893|Ga0335069_11183373All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia838Open in IMG/M
3300033004|Ga0335084_10874307Not Available910Open in IMG/M
3300033158|Ga0335077_11022574All Organisms → cellular organisms → Bacteria822Open in IMG/M
3300033405|Ga0326727_10400263All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1261Open in IMG/M
3300033416|Ga0316622_101769159All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia720Open in IMG/M
3300033513|Ga0316628_103395929All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia577Open in IMG/M
3300033521|Ga0316616_103519047All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia590Open in IMG/M
3300033824|Ga0334840_098144All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → unclassified Terriglobia → Acidobacteriia bacterium 12-62-4812Open in IMG/M
3300033982|Ga0371487_0221547All Organisms → cellular organisms → Bacteria891Open in IMG/M
3300034065|Ga0334827_063057Not Available1320Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil10.89%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland9.90%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil9.90%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen9.90%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.93%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog5.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil3.96%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.96%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment2.97%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.97%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.97%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa2.97%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland1.98%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.98%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.98%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.99%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.99%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.99%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.99%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918008Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Bog_allEnvironmentalOpen in IMG/M
3300004082Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005712Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009636Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_150EnvironmentalOpen in IMG/M
3300009637Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40EnvironmentalOpen in IMG/M
3300009639Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40EnvironmentalOpen in IMG/M
3300009839Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaGEnvironmentalOpen in IMG/M
3300010341Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM2EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300013308Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaGHost-AssociatedOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017948Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_10EnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018017Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018042Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023101Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 10-14EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027853Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1 (SPAdes)EnvironmentalOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027911Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300028571 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch201714.5m_1EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028882Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N2_3EnvironmentalOpen in IMG/M
3300029817Soil microbial communities from Marcell Experimental Forest, Minnesota, USA - Bog25EnvironmentalOpen in IMG/M
3300029907I_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029951III_Palsa_N1 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300031236Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1EnvironmentalOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031250Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031726Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_1EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032782Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.1EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032892Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033416Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_OW2_C1_D5_CEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033521Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_BEnvironmentalOpen in IMG/M
3300033824Peat soil microbial communities from Stordalen Mire, Sweden - 714 S2 5-9EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
Bog_all_C_049013902140918008SoilTVRCKVYIDKEGKISELGTGEQLCETVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK
Ga0062384_10111217723300004082Bog Forest SoilKVVIDEEGKIAELNTGAQLCETVPWSQFRYQPTVKSGHPIRVSAEVEVRFDPRK*
Ga0070734_1010234823300005533Surface SoilKLIIDQTGKVSELETGMQLCESVPWPRFRFQPPVQRGKPVKVKTEVEVRFEPRT*
Ga0070761_1056960023300005591SoilWAPEGGTVHCKLVIDKEGKILELETGAQLCESVPWSQFRYKPTVHGGHPVKVKTEVEVRFDPRK*
Ga0070764_1102675213300005712SoilGKVSELDTGAQLCESVPWSQYRYQPTLKGGHPVKVKTEVAVRFDPRK*
Ga0075030_10068297723300006162WatershedsVSCKVIINPEGKISELETGTQLCEAVPWSQFRYQPPVQGGHPVKVRTEVEVRYEPRK*
Ga0105248_1285626413300009177Switchgrass RhizospherePLWEPAGGTAKCKLIINPDGKIAELETGAQLCEIVPWAQFRYQPPVQGGHPVKVKTEVEIRFEPRKQAS*
Ga0105237_1108284743300009545Corn RhizosphereDGKVDELLTGKQLCEFVDWSKYAYQPTVKGGHPVKVNTDVEVKFKPRVPPTV*
Ga0116112_109673813300009636PeatlandVRCKVVIDPEGKISNLESGTQLCEAVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK*
Ga0116118_113491513300009637PeatlandPLWEPAGGTVRCKVDINPEGKISELETGVQLCEAVPWSQFRYQPPVQGGHPVKVKTEVEVRFEPRK*
Ga0116122_105387713300009639PeatlandQEGRILELETGAQLCESVPWSQFRYKPTVQGGHPVKVETEVEVRFEPRK*
Ga0116223_1067998823300009839Peatlands SoilETGKQLCEFVSWNQYRYQPPVRGGHPVKVSTEVEVTFAPRKPKASS*
Ga0074045_1105166713300010341Bog Forest SoilISDLETGSQLCEAVPWSKFSYKPVVQRGHPVKVSTEVEVRFDPRK*
Ga0136449_10042387413300010379Peatlands SoilNRKEGKISSLETGVQLCEAVPWSQFRYQPPVQGGHPVKVQTEVEVRFEPRK*
Ga0136449_10060803813300010379Peatlands SoilISCKVVIGPEGKISDLETGAQLCETVPWSQFRYQPPVQAGHPVKVATEVEVRFEPRK*
Ga0136449_10217298023300010379Peatlands SoilVRCKVVIDQEVKISDLESGTQLCEAVPWNQFRYQPPVQGGHPVKVDTEVEVRFDPRK*
Ga0136449_10261985823300010379Peatlands SoilLWAPDGETVHCKVTISPEGKILELQTGVQLCEAVPWEQYRYQPPVQGGHPVQVNTEVEVRFEPRK*
Ga0136449_10295456923300010379Peatlands SoilEGKVSELGTGMQLCEAVPWSQFRYQPPVQRGRAVKVKTEVEVRFEPRK*
Ga0137398_1107884423300012683Vadose Zone SoilGGTVRCKVVIDPKGKVSELVTGIQLCETVPWSQFRYQPPVERGHPVKVKTEVEVRFEPRK
Ga0157375_1321244323300013308Miscanthus RhizosphereELETGAQLCEIVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPLK*
Ga0181517_1016159023300014160BogIINAEGKIAALETGIQLCESVPWSQFRYQPPMKGGHPVKVHTEVEVRFEPRQVKP*
Ga0181529_1047988623300014161BogIDPEGKISDLESGTQLCEAVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK*
Ga0181538_1018289233300014162BogETGAQLCETVAWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK*
Ga0181523_1028636323300014165BogLIDQEGKISDLETGMQLCESVPWSQFHYQPLVQKGHPVKVRTEVEVRFDPRK*
Ga0181528_1075396313300014167BogELETGAQLCEAVDWSQYRYQPPVRAGHPVEVRTEVVVQFEPRK*
Ga0181534_1015314523300014168BogSSLETGVQLCEAVPWSQFRYQPPVAGGKPVTVKTEVEVRFDPRK*
Ga0182011_1025073513300014496FenTVSCKVIIGPDGKIAGLDTGKQLCEIVPWSQYRYQPPVQGGHPVKVSTEVEVRFEPRK*
Ga0182011_1048437813300014496FenVVIDPEGKISDLESTTQLCESVTWSQFRYQPPVQGGHPVKVKTEVEVRFEPRK*
Ga0182024_1102059723300014501PermafrostSPAGGTVHCKLVIDKDGKVSELDTGVQLCESVPWSQFSYKPTLRGGHPVQVKTEVEVRFDPRK*
Ga0182021_1037178613300014502FenGKISELESTAQLCETVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK*
Ga0182021_1178797813300014502FenGKISEMESGAQLCETVPWSKFRYQPPVQGGHPVKVKTEVEVRFEPRK*
Ga0182021_1179801723300014502FenGTVRCKVVIDPAGKISELESTAQLCETVPWSKFRYQPPVQDGHPVKVKTEVEVRFEARK*
Ga0182021_1184794613300014502FenGKISELETGAQLCESVPWSQFRYKPTVRRGQPVSVETEVEIRFEPRK*
Ga0182021_1302595413300014502FenVGCKVVIDPQGKISELESTAQLCETVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK*
Ga0182027_1044911413300014839FenSCKVVIDPEGKISDLESTTQLCESVTWSQFRYQPPVQGGHPVKVKTEVEMRFEARK*
Ga0182027_1184343923300014839FenPLWEPEGGTVTCKVVIDPQGKISDLESTAQLCEVVPWSKFRYQPTLQGGHPVKVKTEVEVRFEARK*
Ga0187877_120659913300017931PeatlandGKISDLETGVQLCEAVPWSQFRYQPPVQGGHPVKVRTEVEMRFEPRK
Ga0187877_127230223300017931PeatlandAGGTVRCKVVIGPDGKISELETGVQLCETVPWSQFRYQPPVQGGHPVKVSTEVEVRFEPR
Ga0187847_1078633123300017948PeatlandDQEGKIYFLETGKQLCENVPWQQFRYKPLVQGGHPVKVSTDVEISYEPKK
Ga0187847_1083559913300017948PeatlandGGTVHCKVLINPAGKVSDLETGAQLCETVPWSEFRYQPPVQAGHPVKVRTEVEVRFEPRK
Ga0187780_1017038043300017973Tropical PeatlandVEPAGGTAKCKVVIDTEGKVSELETGQQLCEAVPWDQFRYQPTVRSGHPVKVETEVEVRYEPKKAGS
Ga0187872_1024446723300018017PeatlandVHCPVVIDTEGKISELESGAQLCESVPWSEFSYKPLVQGGHPVKVSTEVEVRFEAHK
Ga0187889_1006792313300018023PeatlandDGKISELESTAQLCESVQWSQFRYKPTVQGGHPVKVKTEVEVRFEPRK
Ga0187881_1040463513300018024PeatlandGTVRCKVDIDPAGKISELETGAQLCETVPWSQFRYQPPVQGGHPVKVRTEVEVRFEPRK
Ga0187869_1016360413300018030PeatlandVQTAPLWEPAGGTVSCKVVIGPEGKISDLETGVQLCEAVPWSQFRYQPPVQGGHPVKVRTEVEMRFEPRK
Ga0187871_1026627513300018042PeatlandPLWQPAGGTVHCKVLIDQEGKISDLETGMQLCESVPWSQFRYQPLVQKGHPVKVRTEVEVRFDPRK
Ga0187766_1145792113300018058Tropical PeatlandPLWEPTGGTARCSVVIGTDGKISDLETGAQLCESVPWDLFRYQPPVQGGHPVKVKTDVEIRFEARK
Ga0181502_111032723300019242PeatlandCKVIIGPDGKISSLETGVQLCESMPWSQFRYQPPVQGGHPVKVNTEIEVRFEPRK
Ga0182028_145176623300019788FenVVIDPEGKISGLETGAQLCETVPWSQFRYQPPVQGGHPVKVKTEVEVRFEARK
Ga0210383_1055810823300021407SoilEGGTVHCKLVVDKEGKISKLETGAQLCESVPWSQFRYKPTVHGGHPVKVKTEVEVRFEPR
Ga0187846_1007513733300021476BiofilmSELATGVQLCEGVAWSQFRYKPTLQGGHPVRVTTEVEVRFEPRK
Ga0213851_100183823300021860WatershedsVRCKVIIDPEGKISELETGAQLCEAVAWSQFRYQPPVQGGHPVKVSTEVEVRFEPRK
Ga0224557_105265723300023101SoilEGKISDLETGAQLCESVPWSQFRYQPPVQGGHPVKVSTEVEVRFEPRK
Ga0208043_105070923300027570Peatlands SoilVINSKGKISELDTGVQLCEAVPWSQFTYQPPVRGGHPVKVSTEVEVKFEPRK
Ga0209178_141315023300027725Agricultural SoilLHTAVIGPEGKVTSLGTGMQLCESVPWSQFRYQPPVQGGHPVRVSTEVEVRFEPRK
Ga0209060_1042912023300027826Surface SoilKLIIDQTGKVSELETGMQLCESVPWPRFRFQPPVQRGKPVKVKTEVEVRFEPRT
Ga0209274_1019084313300027853SoilAPEGGTVHCKLVIDKEGKILELETGAQLCESVPWSQFRYKPTVHGGHPVKVKTEVEVRFDPRK
Ga0209169_1066259613300027879SoilCKVSISEGKVSELDTGAQLCESVPWSQYRYQPTLKGGHPVKVKTEVAVRFDPRK
Ga0209698_1121718413300027911WatershedsPLWEPAGGTVLCKIVINPEGKVSALGTGMQLCESVPWSQFRYQPPVQGGRPVNVKTEVEVRFEPRK
(restricted) Ga0247844_129700213300028571FreshwaterEGGVARCKVIIDAKGKVAELETGAQLCEAVPWDQFRYPPPVQAGRPVRVKTEVEVKFEAQ
Ga0302266_1035464413300028779BogKISDLETGVQLCEAVPWSQFRYQPPVQGGHPVTVRTEVEMRFEPRK
Ga0302201_1003583953300028785BogGTVSCKVVIGPEGKISDLETGVQLCEAVPWSQFRYQPPVQGGHPVTVRTEVEMRFEPRK
Ga0302154_1014592423300028882BogLCESVPWSQFRYQPPVQGGHPVKVSTEVEVRFEPRK
Ga0247275_112299613300029817SoilCKVDINPEGKISELETGVQLCEAVPWSQFRYQPPVQGGHPVKVKTEVEVRFEPRK
Ga0311329_1052791513300029907BogIIDKEGKISDLETGAQLCESVPWSQFRYQPPVQGGHPVKVSTEVEVRFEPRK
Ga0311361_1008327063300029911BogCKVVIGPEGKISDLETGVQLCEAVPWSQFRYQPPVQGGHPVKVRTEVEMRFEPRK
Ga0311361_1070523923300029911BogWGTVRCKIIIDKEGKISDLETGAQLCESVPWSQFRYQPPVQGGHPVKVSTEVEVRFEPRK
Ga0311371_1084474933300029951PalsaGTVHCKVLIGQEGKISDLETGLQLCEAVPWSKFRYQPLVQRGHPVKVRTEVEVRFDPRK
Ga0311334_1196831413300029987FenCKVVIDREGKVSDLESGAQLCETVPWSQFRYQPTVQGGHPVNVKTEVEVRFEPRK
Ga0302196_1031812113300030225BogAGGTVSCKVVIGPEGKISDLETGVQLCEAVPWSQFRYQPPVQGGHPVTVRTEVEMRFEPR
Ga0311357_1029110013300030524PalsaGATVRCRVFISDGKVSELDTGSQLCETVPWSRYRYQPTLKSGHPVKVKTEVEVRFDPRK
Ga0316363_1034177313300030659Peatlands SoilETGKQLCEFVSWNQYRYQPPVRGGHPVKVSTEVEVTFAPRKPKASS
Ga0302324_10011358773300031236PalsaLLEPAGGTVHCKVAIDPEGKISELESFAQLCETVQWSQFRYQPPVQGGHPVRVKTEIEVRFEPRK
Ga0265329_1019510013300031242RhizosphereISPEGKISELETGVQLCESVPWSQFRYQPPVQGGHPVTVKTEVEVRFDPRK
Ga0265331_1040237743300031250RhizosphereSEGKISEVTSFAQLCETTPWSKFRYQPAMQKGHPVKVRTEVEVRFEPRK
Ga0265316_1072920513300031344RhizosphereTVRCKVVISPEGKIAELETGVQLCESVPWSQFRYQPPVQGGHPVTVKTEVEVRFDPRK
Ga0265342_1023218143300031712RhizosphereVSCKVLIDSEGKISEVTSFAQLCETTPWSKFRYQPAMQKGHPVKVRTEVEVRFEPRK
Ga0307474_1091686523300031718Hardwood Forest SoilIGTDGKIAELLTGKQLCEIVPWSQYRYQPTVRNGPVKVNTEIEVRFEPRKPKIAS
Ga0302321_10247809513300031726FenIAALDTGKQLCEIVPWSQYRYHPPVQGGHPVKVSTEVEVRFEPRK
Ga0315285_1063586013300031885SedimentGTVRCRVIIDKEGKISELETGAQLCEAVPWSQFRYQPPVQGGHPVKVKTEVEVRYEPRK
Ga0310910_1129458013300031946SoilEGKIYELGTGTQLCEAVPWSQFRYQPLVQAGHSVKVKTEVEVRFQPRN
Ga0315289_1018971713300032046SedimentTVRCNVLIDTEGKISELQTGAQLCESVPWSQFRYQPLVQRGRPVKVKTEVDVRFEPRK
Ga0315289_1037189313300032046SedimentRCKVVIDKEGKIAELQTGAQLCESVPWSQFRYQPLVQGGRSVKVKTEVEVRFEPRR
Ga0311301_1069761323300032160Peatlands SoilISCKVVIGPEGKISDLETGAQLCETVPWSQFRYQPPVQAGHPVKVATEVEVRFEPRK
Ga0311301_1269223223300032160Peatlands SoilVRCKVVIDPEGKISELESTAQLCETVPWSQFRYKPPVQGGRPVKVDTEVEVRFEPRK
Ga0306920_10153969133300032261SoilARCKVLIGGNGKIADLETGAQLCEAVPWSQFRFQPTVQKGHPVKVHTEVEVKFEPRK
Ga0335085_1101403613300032770SoilKVTIGTDGKIASLDTGAQLCEAVPWDQFQYKPTLQGGNPVKVSTEVEIRFDPRK
Ga0335082_1014957033300032782SoilIGTDGRISELETGVQLCEAVPWSDFHFKPTVQGGHPVTVKTEVEVRFEPRK
Ga0335082_1132854413300032782SoilTVLCKIVINPEGKVSELGTGMQLCESVPWSQFRYQPPVQGGHPVNVKTEVEVRFEPRK
Ga0335079_1180555913300032783SoilLWEPKGGTVQCKVVINSEGKVSDLESGTQLCESVPWSQFRYKPLQQRGHAVKVKTEVEVRFEPRK
Ga0335081_1270886323300032892SoilDGKISDLDTGAQLCEAVPWSQFHFQAPVQGGHPVKVKTEVEVRFDPRK
Ga0335069_1118337313300032893SoilSEGKISELETGAQLCESVPWGEFRYQPPMKGGKPAKASTEVEIHFEARK
Ga0335084_1087430733300033004SoilNGKISELETGNQLCEAIDWEKYRYTPATQGGKPVQVRTEVEVTFDPRK
Ga0335077_1102257423300033158SoilIDEEGKISKLQTGNQLCESVSWDHVRFKPTVQRGHAVKVKTEVEVKFEPRK
Ga0326727_1040026313300033405Peat SoilCKVVIGPDGKISELESTAQLCESVQWSQFSYKPTVKGGKPVKVRTEVEVRFEARK
Ga0316622_10176915913300033416SoilCKVVIDKEGKVSELQTGAQLCEAVPWSQFRYQPPVQGGRPVRVKTEVEVRFDPRK
Ga0316628_10339592913300033513SoilWEPAAGTVRCKVVINPEGKIIELETGAQLCEAVPWAQFRYQPTVQGGHPVRVKTEVEIRFEPRK
Ga0316616_10351904713300033521SoilCKVIIGPDGKISKLDTGAQLCEAVQWDQFKYQPLLKGGRPVSVKTEVEVRYEPRK
Ga0334840_098144_27_1883300033824SoilVDIDPEGKISDLETGVQLCESVPWDQFRYQPPVRGGHPVNVKTEVEVRFEPRK
Ga0371487_0221547_97_2583300033982Peat SoilVVIGPDGKISELVSAAQLCESVQWSQFRFQPTVKGGHPVKVRTEVEVKFEARK
Ga0334827_063057_2_1933300034065SoilQPEGGTVRCKIIIDKEGKISDLETGAQLCESVPWSQFRYQPPVQGGHPVKVSTEVEVRFEPRK

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.