Basic Information | |
---|---|
Family ID | F102611 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 45 residues |
Representative Sequence | RFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK |
Number of Associated Samples | 88 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 93.07 % |
Associated GOLD sequencing projects | 82 |
AlphaFold2 3D model prediction | No |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (99.010 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine (14.852 % of family members) |
Environment Ontology (ENVO) | Unclassified (53.465 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.089 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 65.91% β-sheet: 4.55% Coil/Unstructured: 29.55% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF00218 | IGPS | 79.21 |
PF00591 | Glycos_transf_3 | 14.85 |
PF00117 | GATase | 2.97 |
PF02885 | Glycos_trans_3N | 0.99 |
PF00425 | Chorismate_bind | 0.99 |
PF12163 | HobA | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG0134 | Indole-3-glycerol phosphate synthase | Amino acid transport and metabolism [E] | 79.21 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 99.01 % |
Unclassified | root | N/A | 0.99 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000101|DelMOSum2010_c10018920 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 4079 | Open in IMG/M |
3300000117|DelMOWin2010_c10097019 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1093 | Open in IMG/M |
3300000117|DelMOWin2010_c10117971 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 934 | Open in IMG/M |
3300000117|DelMOWin2010_c10199799 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 616 | Open in IMG/M |
3300000199|SI39nov09_10mDRAFT_c1010021 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 851 | Open in IMG/M |
3300001349|JGI20160J14292_10070399 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1412 | Open in IMG/M |
3300001352|JGI20157J14317_10115082 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 923 | Open in IMG/M |
3300001353|JGI20159J14440_10096722 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 944 | Open in IMG/M |
3300001353|JGI20159J14440_10107366 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 871 | Open in IMG/M |
3300001354|JGI20155J14468_10047148 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1867 | Open in IMG/M |
3300001354|JGI20155J14468_10106635 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 974 | Open in IMG/M |
3300001355|JGI20158J14315_10159367 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 680 | Open in IMG/M |
3300003478|JGI26238J51125_1023323 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1458 | Open in IMG/M |
3300005735|Ga0076923_101510 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2634 | Open in IMG/M |
3300005971|Ga0066370_10282333 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
3300007229|Ga0075468_10108086 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
3300007623|Ga0102948_1114189 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 830 | Open in IMG/M |
3300007725|Ga0102951_1073987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 978 | Open in IMG/M |
3300007725|Ga0102951_1179961 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 596 | Open in IMG/M |
3300007776|Ga0105674_1231447 | Not Available | 854 | Open in IMG/M |
3300007862|Ga0105737_1046194 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1050 | Open in IMG/M |
3300007954|Ga0105739_1058127 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 849 | Open in IMG/M |
3300007956|Ga0105741_1057776 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 952 | Open in IMG/M |
3300008253|Ga0105349_10296587 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300009027|Ga0102957_1333718 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 559 | Open in IMG/M |
3300009440|Ga0115561_1347758 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 544 | Open in IMG/M |
3300009481|Ga0114932_10877153 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 518 | Open in IMG/M |
3300009498|Ga0115568_10163590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1050 | Open in IMG/M |
3300009790|Ga0115012_10503218 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 947 | Open in IMG/M |
3300012928|Ga0163110_11151501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 622 | Open in IMG/M |
3300012936|Ga0163109_10316446 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1143 | Open in IMG/M |
3300012953|Ga0163179_10412838 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1098 | Open in IMG/M |
3300012954|Ga0163111_10746968 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 927 | Open in IMG/M |
3300012954|Ga0163111_12034471 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 579 | Open in IMG/M |
3300017717|Ga0181404_1101222 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 706 | Open in IMG/M |
3300017728|Ga0181419_1028289 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1540 | Open in IMG/M |
3300017729|Ga0181396_1009095 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1999 | Open in IMG/M |
3300017730|Ga0181417_1136090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 593 | Open in IMG/M |
3300017741|Ga0181421_1079501 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
3300017749|Ga0181392_1038981 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1477 | Open in IMG/M |
3300017749|Ga0181392_1098296 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 875 | Open in IMG/M |
3300017758|Ga0181409_1096160 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 885 | Open in IMG/M |
3300017762|Ga0181422_1043083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1457 | Open in IMG/M |
3300017773|Ga0181386_1185421 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 629 | Open in IMG/M |
3300017781|Ga0181423_1118140 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1032 | Open in IMG/M |
3300017786|Ga0181424_10322869 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 639 | Open in IMG/M |
3300017824|Ga0181552_10425463 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 633 | Open in IMG/M |
3300017950|Ga0181607_10188679 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1220 | Open in IMG/M |
3300017950|Ga0181607_10563991 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 602 | Open in IMG/M |
3300018424|Ga0181591_11010970 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
3300018428|Ga0181568_10949045 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 657 | Open in IMG/M |
3300018428|Ga0181568_11102131 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 600 | Open in IMG/M |
3300018428|Ga0181568_11445797 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 509 | Open in IMG/M |
3300019283|Ga0182058_1264344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 643 | Open in IMG/M |
3300020052|Ga0181554_1037571 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2765 | Open in IMG/M |
3300020191|Ga0181604_10259733 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 809 | Open in IMG/M |
3300020207|Ga0181570_10192650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1085 | Open in IMG/M |
3300020267|Ga0211648_1008746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 2466 | Open in IMG/M |
3300020280|Ga0211591_1044922 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 939 | Open in IMG/M |
3300020282|Ga0211667_1084019 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 781 | Open in IMG/M |
3300020289|Ga0211621_1015302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1274 | Open in IMG/M |
3300020377|Ga0211647_10079330 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1154 | Open in IMG/M |
3300020378|Ga0211527_10145745 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 676 | Open in IMG/M |
3300020381|Ga0211476_10025029 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2687 | Open in IMG/M |
3300020388|Ga0211678_10162339 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 953 | Open in IMG/M |
3300020404|Ga0211659_10076312 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1562 | Open in IMG/M |
3300020408|Ga0211651_10262344 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 659 | Open in IMG/M |
3300020431|Ga0211554_10099897 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1482 | Open in IMG/M |
3300020449|Ga0211642_10219566 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 819 | Open in IMG/M |
3300020450|Ga0211641_10111768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1394 | Open in IMG/M |
3300020450|Ga0211641_10124728 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1310 | Open in IMG/M |
3300020450|Ga0211641_10548025 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300021085|Ga0206677_10241438 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300021365|Ga0206123_10310098 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 669 | Open in IMG/M |
3300021958|Ga0222718_10133124 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1423 | Open in IMG/M |
3300022909|Ga0255755_1149338 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 948 | Open in IMG/M |
3300022925|Ga0255773_10225888 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 822 | Open in IMG/M |
(restricted) 3300023109|Ga0233432_10183567 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1061 | Open in IMG/M |
3300023172|Ga0255766_10359944 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 717 | Open in IMG/M |
3300024237|Ga0228653_1068533 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 783 | Open in IMG/M |
3300024291|Ga0228660_1094685 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 585 | Open in IMG/M |
3300024313|Ga0228624_1077152 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 618 | Open in IMG/M |
3300024321|Ga0228626_1013803 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2271 | Open in IMG/M |
3300024415|Ga0228662_1033608 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1373 | Open in IMG/M |
3300024417|Ga0228650_1102466 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 777 | Open in IMG/M |
3300025690|Ga0209505_1025227 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 2178 | Open in IMG/M |
3300025712|Ga0209305_1087934 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1010 | Open in IMG/M |
3300025767|Ga0209137_1249952 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 564 | Open in IMG/M |
3300025880|Ga0209534_10218697 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 937 | Open in IMG/M |
3300025886|Ga0209632_10126990 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter | 1441 | Open in IMG/M |
3300025890|Ga0209631_10541780 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 508 | Open in IMG/M |
3300026130|Ga0209961_1059078 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 723 | Open in IMG/M |
3300027774|Ga0209433_10078828 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1203 | Open in IMG/M |
3300027830|Ga0209359_10287467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 751 | Open in IMG/M |
3300027830|Ga0209359_10368059 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 662 | Open in IMG/M |
3300028129|Ga0228634_1044681 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1154 | Open in IMG/M |
3300028174|Ga0257123_1087030 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 726 | Open in IMG/M |
3300028280|Ga0228646_1154159 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 552 | Open in IMG/M |
3300028282|Ga0256413_1277987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 592 | Open in IMG/M |
3300028419|Ga0228625_1043890 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1013 | Open in IMG/M |
3300031851|Ga0315320_10309538 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Pelagibacterales → Pelagibacteraceae → Candidatus Pelagibacter → Candidatus Pelagibacter ubique | 1123 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 14.85% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 13.86% |
Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.88% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 9.90% |
Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 9.90% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 4.95% |
Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 3.96% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 3.96% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 3.96% |
Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Water | 3.96% |
Estuary Water | Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water | 2.97% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 2.97% |
Seawater | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater | 1.98% |
Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.99% |
Marine | Environmental → Aquatic → Marine → Inlet → Unclassified → Marine | 0.99% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.99% |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 0.99% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.99% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.99% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 0.99% |
Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.99% |
Diffuse Vent Fluid, Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Diffuse Flow → Diffuse Vent Fluid, Hydrothermal Vents | 0.99% |
Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 0.99% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000101 | Marine microbial communities from Delaware Coast, sample from Delaware MO Early Summer May 2010 | Environmental | Open in IMG/M |
3300000117 | Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010 | Environmental | Open in IMG/M |
3300000199 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 39 11/10/09 10m | Environmental | Open in IMG/M |
3300001349 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 | Environmental | Open in IMG/M |
3300001352 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 | Environmental | Open in IMG/M |
3300001353 | Pelagic Microbial community sample from North Sea - COGITO 998_met_09 | Environmental | Open in IMG/M |
3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
3300001355 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 | Environmental | Open in IMG/M |
3300003478 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNA | Environmental | Open in IMG/M |
3300005735 | Seawater microbial communities from Vineyard Sound, MA, USA - control T0 | Environmental | Open in IMG/M |
3300005971 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_SurfaceA_ad_5m_LV_A | Environmental | Open in IMG/M |
3300007229 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA | Environmental | Open in IMG/M |
3300007623 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_A_H2O_MG | Environmental | Open in IMG/M |
3300007725 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG | Environmental | Open in IMG/M |
3300007776 | Diffuse hydrothermal flow volcanic vent microbial communities from Axial Seamount, northeast Pacific ocean - Sample FS915_Marker113_DNA CLC_assembly | Environmental | Open in IMG/M |
3300007862 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373A_0.2um | Environmental | Open in IMG/M |
3300007954 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1373B_0.2um | Environmental | Open in IMG/M |
3300007956 | Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1459A_0.2um | Environmental | Open in IMG/M |
3300008253 | Methane-oxidizing microbial communities from mesocosms in the Hudson Canyon - EN1B Hudson Canyon | Environmental | Open in IMG/M |
3300009027 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MG | Environmental | Open in IMG/M |
3300009440 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110512 | Environmental | Open in IMG/M |
3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
3300009498 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_120426 | Environmental | Open in IMG/M |
3300009790 | Marine eukaryotic phytoplankton communities from Atlantic Ocean - Tropical Atlantic ANT10 Metagenome | Environmental | Open in IMG/M |
3300012928 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaG | Environmental | Open in IMG/M |
3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
3300012953 | Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 Metagenome | Environmental | Open in IMG/M |
3300012954 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaG | Environmental | Open in IMG/M |
3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
3300017729 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 19 SPOT_SRF_2011-01-11 | Environmental | Open in IMG/M |
3300017730 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13 | Environmental | Open in IMG/M |
3300017741 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 44 SPOT_SRF_2013-06-19 | Environmental | Open in IMG/M |
3300017749 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 15 SPOT_SRF_2010-09-15 | Environmental | Open in IMG/M |
3300017758 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 32 SPOT_SRF_2012-05-30 | Environmental | Open in IMG/M |
3300017762 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18 | Environmental | Open in IMG/M |
3300017773 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 9 SPOT_SRF_2010-03-24 | Environmental | Open in IMG/M |
3300017781 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 46 SPOT_SRF_2013-08-14 | Environmental | Open in IMG/M |
3300017786 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 47 SPOT_SRF_2013-09-18 | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017950 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041413US metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018428 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019283 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 101404CT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300020052 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011503CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020191 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041410US metaG (spades assembly) | Environmental | Open in IMG/M |
3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020267 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556026-ERR599108) | Environmental | Open in IMG/M |
3300020280 | Marine microbial communities from Tara Oceans - TARA_B100001121 (ERX556044-ERR599114) | Environmental | Open in IMG/M |
3300020282 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX556074-ERR599169) | Environmental | Open in IMG/M |
3300020289 | Marine microbial communities from Tara Oceans - TARA_B100000242 (ERX556122-ERR599019) | Environmental | Open in IMG/M |
3300020377 | Marine microbial communities from Tara Oceans - TARA_B100000927 (ERX556007-ERR599065) | Environmental | Open in IMG/M |
3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
3300020381 | Marine microbial communities from Tara Oceans - TARA_A100001011 (ERX291769-ERR318620) | Environmental | Open in IMG/M |
3300020388 | Marine microbial communities from Tara Oceans - TARA_B100001063 (ERX555965-ERR599064) | Environmental | Open in IMG/M |
3300020404 | Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978) | Environmental | Open in IMG/M |
3300020408 | Marine microbial communities from Tara Oceans - TARA_B100000925 (ERX555963-ERR599118) | Environmental | Open in IMG/M |
3300020431 | Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983) | Environmental | Open in IMG/M |
3300020449 | Marine microbial communities from Tara Oceans - TARA_B100001079 (ERX556008-ERR599020) | Environmental | Open in IMG/M |
3300020450 | Marine microbial communities from Tara Oceans - TARA_B100000575 (ERX555933-ERR599077) | Environmental | Open in IMG/M |
3300021085 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 30m 12015 | Environmental | Open in IMG/M |
3300021365 | Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160316_1 | Environmental | Open in IMG/M |
3300021958 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27D | Environmental | Open in IMG/M |
3300022909 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG | Environmental | Open in IMG/M |
3300022925 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011502XT metaG | Environmental | Open in IMG/M |
3300023109 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_10_MG | Environmental | Open in IMG/M |
3300023172 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG | Environmental | Open in IMG/M |
3300024237 | Seawater microbial communities from Monterey Bay, California, United States - 65D | Environmental | Open in IMG/M |
3300024291 | Seawater microbial communities from Monterey Bay, California, United States - 74D | Environmental | Open in IMG/M |
3300024313 | Seawater microbial communities from Monterey Bay, California, United States - 29D | Environmental | Open in IMG/M |
3300024321 | Seawater microbial communities from Monterey Bay, California, United States - 31D | Environmental | Open in IMG/M |
3300024415 | Seawater microbial communities from Monterey Bay, California, United States - 76D | Environmental | Open in IMG/M |
3300024417 | Seawater microbial communities from Monterey Bay, California, United States - 62D | Environmental | Open in IMG/M |
3300025690 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110331 (SPAdes) | Environmental | Open in IMG/M |
3300025712 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110321 (SPAdes) | Environmental | Open in IMG/M |
3300025767 | Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_105LU_22_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025880 | Pelagic Microbial community sample from North Sea - COGITO 998_met_07 (SPAdes) | Environmental | Open in IMG/M |
3300025886 | Pelagic Microbial community sample from North Sea - COGITO 998_met_10 (SPAdes) | Environmental | Open in IMG/M |
3300025890 | Pelagic Microbial community sample from North Sea - COGITO 998_met_08 (SPAdes) | Environmental | Open in IMG/M |
3300026130 | Water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG R2A_B_H2O_MG (SPAdes) | Environmental | Open in IMG/M |
3300027774 | Marine microbial communities from oxygen minimum zone in mesopelagic equatorial Pacific - METZYME_5_50m (SPAdes) | Environmental | Open in IMG/M |
3300027830 | Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - Surface_A/KNORR_S2/LV (SPAdes) | Environmental | Open in IMG/M |
3300028129 | Seawater microbial communities from Monterey Bay, California, United States - 42D | Environmental | Open in IMG/M |
3300028174 | Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_135 | Environmental | Open in IMG/M |
3300028280 | Seawater microbial communities from Monterey Bay, California, United States - 58D | Environmental | Open in IMG/M |
3300028282 | Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - WCR_77 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300028419 | Seawater microbial communities from Monterey Bay, California, United States - 30D | Environmental | Open in IMG/M |
3300031851 | Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 40m 21515 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSum2010_100189201 | 3300000101 | Marine | NKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
DelMOWin2010_100970191 | 3300000117 | Marine | NKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKKSSKIGVNLTTKQRK* |
DelMOWin2010_101179711 | 3300000117 | Marine | INKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK* |
DelMOWin2010_101997992 | 3300000117 | Marine | RFFCFLVSIRTNIVQIMFYKSSYKETIVKKISKIGV* |
SI39nov09_10mDRAFT_10100212 | 3300000199 | Marine | IRTNIVQIMFYKSSYQXTIAKKSSKIGVNLTTKQRK* |
JGI20160J14292_100703991 | 3300001349 | Pelagic Marine | IRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
JGI20157J14317_101150821 | 3300001352 | Pelagic Marine | INKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKKSSKIGVNLTTKQRK* |
JGI20159J14440_100967221 | 3300001353 | Pelagic Marine | FCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
JGI20159J14440_101073661 | 3300001353 | Pelagic Marine | KSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKISKIGVKLTIKLKK* |
JGI20155J14468_100471481 | 3300001354 | Pelagic Marine | NKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK* |
JGI20155J14468_101066352 | 3300001354 | Pelagic Marine | FFCFLVSIRTNIVQIMFYKSSYQLTIAKKSSKIGLI* |
JGI20158J14315_101593671 | 3300001355 | Pelagic Marine | LVSIRTNIVQIMFYKSSYQLTIAKKSSKIGVNLTTKQRK* |
JGI26238J51125_10233231 | 3300003478 | Marine | FFCFFVSIRTNIVQIMFYKSSSNITIVKNTSKIGVYLTIKLKN* |
Ga0076923_1015105 | 3300005735 | Marine | SRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK* |
Ga0066370_102823331 | 3300005971 | Marine | RTNIVQIMFYKSSFKLTILKKTSKIGLYLTIKLKK* |
Ga0075468_101080862 | 3300007229 | Aqueous | RFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
Ga0102948_11141891 | 3300007623 | Water | RFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK* |
Ga0102951_10739872 | 3300007725 | Water | YEGETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK* |
Ga0102951_11799612 | 3300007725 | Water | FFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLKK* |
Ga0105674_12314472 | 3300007776 | Diffuse Vent Fluid, Hydrothermal Vents | FLVSIRTNIVQIMFYKSSYQLTIAKKSSKIGVNLTTKQRK* |
Ga0105737_10461943 | 3300007862 | Estuary Water | FFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
Ga0105739_10581272 | 3300007954 | Estuary Water | GETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
Ga0105741_10577762 | 3300007956 | Estuary Water | LLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
Ga0105349_102965871 | 3300008253 | Methane Seep Mesocosm | SIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
Ga0102957_13337181 | 3300009027 | Pond Water | TNIVQIMFYKSSYKETIVKKLSKIRLNLTTKLKK* |
Ga0115561_13477582 | 3300009440 | Pelagic Marine | RFFCFLVSIRTNIVQIMFYKSSYKETIVKKTSKIGVKLTTKLRK* |
Ga0114932_108771531 | 3300009481 | Deep Subsurface | PELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK* |
Ga0115568_101635903 | 3300009498 | Pelagic Marine | LVSIRTNIVQIMFYKSSYKETIVKKISKIGINLTTKLRK* |
Ga0115012_105032181 | 3300009790 | Marine | INKSRFFCFLVSIRTNIVQIMFYKSSFDLTILKKANKIGVYLTIKLKI* |
Ga0163110_111515012 | 3300012928 | Surface Seawater | ETPELLNFLLINKSRFFCFLVSIRTNIVQTMFYKSSFDLTILKKTNKIGVYLTIKLKI* |
Ga0163109_103164461 | 3300012936 | Surface Seawater | EGETPELLNFLLINNNKFFCFFVSIRTNNVQIMFYKSSFNLTIVKKLSKIRENLTIKLKK |
Ga0163179_104128383 | 3300012953 | Seawater | LLINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKTSKIGVKLTTKLRK* |
Ga0163111_107469682 | 3300012954 | Surface Seawater | NKSRFFCFLVSIRTNIVQIMFYKSSFDLTILKKTNKIGVYLAIKLKI* |
Ga0163111_120344711 | 3300012954 | Surface Seawater | EGETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKPSKIGVKLTIKLKK |
Ga0181404_11012221 | 3300017717 | Seawater | INKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLKK |
Ga0181419_10282893 | 3300017728 | Seawater | NLLLINKSKFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGANLTIKQKK |
Ga0181396_10090953 | 3300017729 | Seawater | ETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0181417_11360902 | 3300017730 | Seawater | SIRTNIVQIMFYKSSYKETIVKKTSKIGVKLTTKLRK |
Ga0181421_10795011 | 3300017741 | Seawater | RFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0181392_10389813 | 3300017749 | Seawater | FLVSIRTNIVQTMFYKSSFDLTILKKTNKIGVYLTIKLKI |
Ga0181392_10982962 | 3300017749 | Seawater | FLVSIRTNIVQTMFYKSSFDLTILKKTNKIGVYLSIKLKI |
Ga0181409_10961602 | 3300017758 | Seawater | FLVSIRTNIVQIMFYKSSYKETIVKKISKIGVNLTTKLRK |
Ga0181422_10430831 | 3300017762 | Seawater | NFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0181386_11854211 | 3300017773 | Seawater | FFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLRK |
Ga0181423_11181403 | 3300017781 | Seawater | APELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0181424_103228692 | 3300017786 | Seawater | CFLVSIRTNIVQMMFYKSSFDLTIAKKTNKIGIYLTTKLKI |
Ga0181552_104254632 | 3300017824 | Salt Marsh | CFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLKK |
Ga0181607_101886791 | 3300017950 | Salt Marsh | FFCFLVSIRTNIVQIMFYKSSFDLTILKNTNKIGVYLTIKLKI |
Ga0181607_105639912 | 3300017950 | Salt Marsh | LVSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLKK |
Ga0181591_110109702 | 3300018424 | Salt Marsh | VSIRTNIVQIMFYKSSFKLTILKKTSKVGLYLTKELKK |
Ga0181568_109490452 | 3300018428 | Salt Marsh | SIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLRK |
Ga0181568_111021311 | 3300018428 | Salt Marsh | INNNKFFCFFVSIRTNIVQIMFYKSSFNLTIVKKISKIGDNLTIKLKK |
Ga0181568_114457972 | 3300018428 | Salt Marsh | INNNKFFCFFVSIRTNIVQIMFYKSSFNLTIVKKISKIGDKLTIKLKK |
Ga0182058_12643442 | 3300019283 | Salt Marsh | SIRTNIVQIMFYKSSYKETIVKKPSKIGVKLTIKLKK |
Ga0181554_10375711 | 3300020052 | Salt Marsh | CFLVSIRKNIVQIMFYKSSYKETIVKKLSKIRVNLTTKLRK |
Ga0181604_102597331 | 3300020191 | Salt Marsh | EGDTPELLNFLLINKSRFFCFFVSIRTNIVQNLFYKSSLQFTIAKKANKIGDYSTKELKK |
Ga0181570_101926503 | 3300020207 | Salt Marsh | FVSIRTNIVQIMFYKSSFKLTILKKTSKIGLYLAIKQKK |
Ga0211648_10087461 | 3300020267 | Marine | IRTNIVQIMFYKSSFDLTILKKPNKIGVYLAIKLKI |
Ga0211591_10449221 | 3300020280 | Marine | FCFFVSIRTNIVQTMFYKSSFKLTIVKKTSKIGLYLTIKQKK |
Ga0211667_10840192 | 3300020282 | Marine | VSIRTNIVQIMFYKSSFDLTILKKTNKIGVYLAIKLKI |
Ga0211621_10153023 | 3300020289 | Marine | FFVSIRTNIVQTMFYKSSFKLTILKKTSKIGLYLTIKLKI |
Ga0211647_100793303 | 3300020377 | Marine | IRTNIVQIMFYKSSFDLTILKKTNKIGVYLAIKLKI |
Ga0211527_101457451 | 3300020378 | Marine | FFCFLVSIRTNIVQTMFYKSSFDLTILKKTNKIGVYLAIKLKI |
Ga0211476_100250295 | 3300020381 | Marine | PELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0211678_101623391 | 3300020388 | Marine | NKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0211659_100763121 | 3300020404 | Marine | ETPELLNFLLINKSRFFCFLVSIRTNIVQTMFYKSSFDLTILKKTNKIGVYLSIKLKI |
Ga0211651_102623442 | 3300020408 | Marine | LVSIRTNIVQIMFYKSSFDLTILKKPNKIGVYLAIKLKI |
Ga0211554_100998971 | 3300020431 | Marine | ISSYEGETPELLNFLLINKSRFFCFFVSIRTNIVQNLFYKSSLQLTIVKKANKIGRYLTKELKK |
Ga0211642_102195661 | 3300020449 | Marine | SIRTNIVQTMFYKSSFKLTILKKTSKIGLYLTIKQKK |
Ga0211641_101117683 | 3300020450 | Marine | FVSIRTNIVQTMFYKSSFKLTILKNTSKIELNLTIKQKK |
Ga0211641_101247281 | 3300020450 | Marine | FVSIRTNIVQIMFYKSSFKLTILKKTSKIGLYLTIKLKK |
Ga0211641_105480252 | 3300020450 | Marine | LVNIRTNIVQIMFYKSSFDLTILKKPNKIGVYLAIKLKI |
Ga0206677_102414382 | 3300021085 | Seawater | CFLVSIRTNIVQTMFYKSSYKETIQKKSSKYGVNLITKQRK |
Ga0206123_103100981 | 3300021365 | Seawater | RTNIVQIMFYKSSYQLTIAKKSSKIRVNLTTKLRK |
Ga0222718_101331241 | 3300021958 | Estuarine Water | LINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKISKIGVKLTIKLKK |
Ga0255755_11493382 | 3300022909 | Salt Marsh | SIRTNIVQIMFYKSSYKETIVKKHSKIGLNLTTKLRK |
Ga0255773_102258881 | 3300022925 | Salt Marsh | VSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLRK |
(restricted) Ga0233432_101835673 | 3300023109 | Seawater | FLVSIRTNIVQIMFYKSSYQLTIAKKSSKIGVNLTTKQRK |
Ga0255766_103599441 | 3300023172 | Salt Marsh | CFFVSIRTNIVQIMFYKSSFKLTILKKTSKIGLNLAIKQKK |
Ga0228653_10685332 | 3300024237 | Seawater | FVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0228660_10946851 | 3300024291 | Seawater | LVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0228624_10771521 | 3300024313 | Seawater | NKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKASKIGVKLTIKLKK |
Ga0228626_10138031 | 3300024321 | Seawater | ETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK |
Ga0228662_10336081 | 3300024415 | Seawater | PELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTAKLRK |
Ga0228650_11024662 | 3300024417 | Seawater | NKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGLNLTTKLKK |
Ga0209505_10252271 | 3300025690 | Pelagic Marine | NFLLINKSRFFCFLVSIRTNIVHTMFYKSSYQLTIAKKSSKIGVNLTTKQRK |
Ga0209305_10879341 | 3300025712 | Pelagic Marine | KSRFFCFLVNIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0209137_12499521 | 3300025767 | Marine | LVSIRTNIVQIMFYKSSYKETIVKKLSKIEVNLTTKLRK |
Ga0209534_102186971 | 3300025880 | Pelagic Marine | INKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKKSSKIGVNLTTKQRK |
Ga0209632_101269903 | 3300025886 | Pelagic Marine | LINKSRFFCFLVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK |
Ga0209631_105417802 | 3300025890 | Pelagic Marine | RFFCFLVSIRTNIVQIMFYKSSYKETIVKKISKIGVKLTIKLKK |
Ga0209961_10590781 | 3300026130 | Water | FLVSIRTNIVQIMFYKSSYKETIVKKISKIGVKLTIKLKK |
Ga0209433_100788283 | 3300027774 | Marine | FLLINKSKFFCFFVSIRTNIVQIMFYKSSFQLTIAKKASKIGPYLSIKQKK |
Ga0209359_102874672 | 3300027830 | Marine | CFFVSIRTNIVQIMFYKSSFKLTILKKTSKIGLYLAIKQKK |
Ga0209359_103680591 | 3300027830 | Marine | FLVSIRTNIVQIMFYKSSFDLTILKKTNKIEVYLTIKLKI |
Ga0228634_10446811 | 3300028129 | Seawater | LVSIRTNIVQIMFYKSSYKETIVKKLSKIGVNLTTKLRK |
Ga0257123_10870302 | 3300028174 | Marine | RTNIVQIMFYKSSYRLTIAKLFSKIGVNLTTKQRK |
Ga0228646_11541592 | 3300028280 | Seawater | IRTNIVQIMFYKSSYKETIVKKLSKIGVNLITKLRK |
Ga0256413_12779871 | 3300028282 | Seawater | ETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGANLTIKQKK |
Ga0228625_10438902 | 3300028419 | Seawater | GETPELLNFLLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
Ga0315320_103095383 | 3300031851 | Seawater | LLINKSRFFCFLVSIRTNIVQIMFYKSSYQLTIAKLLSKIGVNLTTKQKK |
⦗Top⦘ |