NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F102792

Metagenome / Metatranscriptome Family F102792

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102792
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 37 residues
Representative Sequence MKKTSITVTEAARNFADCVNRAHYQNVTFVLLKNG
Number of Associated Samples 95
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 13.86 %
% of genes near scaffold ends (potentially truncated) 97.03 %
% of genes from short scaffolds (< 2000 bps) 91.09 %
Associated GOLD sequencing projects 94
AlphaFold2 3D model prediction Yes
3D model pTM-score0.50

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (86.139 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa
(6.931 % of family members)
Environment Ontology (ENVO) Unclassified
(26.733 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.525 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 26.98%    β-sheet: 0.00%    Coil/Unstructured: 73.02%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.50
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03544TonB_C 6.93
PF02195ParBc 5.94
PF02604PhdYeFM_antitox 4.95
PF00069Pkinase 3.96
PF03739LptF_LptG 2.97
PF13614AAA_31 1.98
PF14534DUF4440 1.98
PF030614HBT 0.99
PF00717Peptidase_S24 0.99
PF01434Peptidase_M41 0.99
PF13470PIN_3 0.99
PF17132Glyco_hydro_106 0.99
PF00488MutS_V 0.99
PF13103TonB_2 0.99
PF00578AhpC-TSA 0.99
PF02754CCG 0.99
PF13173AAA_14 0.99
PF01402RHH_1 0.99
PF13565HTH_32 0.99
PF01346FKBP_N 0.99
PF01180DHO_dh 0.99
PF13714PEP_mutase 0.99
PF00005ABC_tran 0.99
PF13744HTH_37 0.99
PF02537CRCB 0.99
PF00919UPF0004 0.99
PF02843GARS_C 0.99
PF01833TIG 0.99
PF135632_5_RNA_ligase2 0.99
PF03352Adenine_glyco 0.99
PF03030H_PPase 0.99
PF13520AA_permease_2 0.99
PF02518HATPase_c 0.99
PF13502AsmA_2 0.99
PF13320DUF4091 0.99
PF08840BAAT_C 0.99
PF13007LZ_Tnp_IS66 0.99
PF01545Cation_efflux 0.99
PF01370Epimerase 0.99
PF03358FMN_red 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0515Serine/threonine protein kinaseSignal transduction mechanisms [T] 15.84
COG0810Periplasmic protein TonB, links inner and outer membranesCell wall/membrane/envelope biogenesis [M] 6.93
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 4.95
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 4.95
COG0795Lipopolysaccharide export LptBFGC system, permease protein LptFCell wall/membrane/envelope biogenesis [M] 2.97
COG0042tRNA-dihydrouridine synthaseTranslation, ribosomal structure and biogenesis [J] 0.99
COG0053Divalent metal cation (Fe/Co/Zn/Cd) efflux pumpInorganic ion transport and metabolism [P] 0.99
COG0069Glutamate synthase domain 2Amino acid transport and metabolism [E] 0.99
COG0151Phosphoribosylamine-glycine ligaseNucleotide transport and metabolism [F] 0.99
COG0167Dihydroorotate dehydrogenaseNucleotide transport and metabolism [F] 0.99
COG0239Fluoride ion exporter CrcB/FEX, affects chromosome condensationCell cycle control, cell division, chromosome partitioning [D] 0.99
COG0247Fe-S cluster-containing oxidoreductase, includes glycolate oxidase subunit GlcFEnergy production and conversion [C] 0.99
COG0249DNA mismatch repair ATPase MutSReplication, recombination and repair [L] 0.99
COG0465ATP-dependent Zn proteasesPosttranslational modification, protein turnover, chaperones [O] 0.99
COG0545FKBP-type peptidyl-prolyl cis-trans isomerasePosttranslational modification, protein turnover, chaperones [O] 0.99
COG0621tRNA A37 methylthiotransferase MiaBTranslation, ribosomal structure and biogenesis [J] 0.99
COG1193dsDNA-specific endonuclease/ATPase MutS2Replication, recombination and repair [L] 0.99
COG1230Co/Zn/Cd efflux system componentInorganic ion transport and metabolism [P] 0.99
COG1304FMN-dependent dehydrogenase, includes L-lactate dehydrogenase and type II isopentenyl diphosphate isomeraseEnergy production and conversion [C] 0.99
COG2048Heterodisulfide reductase, subunit BEnergy production and conversion [C] 0.99
COG2070NAD(P)H-dependent flavin oxidoreductase YrpB, nitropropane dioxygenase familyGeneral function prediction only [R] 0.99
COG28183-methyladenine DNA glycosylase TagReplication, recombination and repair [L] 0.99
COG3808Na+ or H+-translocating membrane pyrophosphataseEnergy production and conversion [C] 0.99
COG3965Predicted Co/Zn/Cd cation transporter, cation efflux familyInorganic ion transport and metabolism [P] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.14 %
UnclassifiedrootN/A13.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2088090014|GPIPI_16834612All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1301Open in IMG/M
3300001593|JGI12635J15846_10056166All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium2974Open in IMG/M
3300004635|Ga0062388_101090776All Organisms → cellular organisms → Bacteria782Open in IMG/M
3300004806|Ga0007854_10291459All Organisms → cellular organisms → Bacteria677Open in IMG/M
3300005177|Ga0066690_10957926All Organisms → cellular organisms → Bacteria542Open in IMG/M
3300005445|Ga0070708_102018495All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068534Open in IMG/M
3300005529|Ga0070741_11579202All Organisms → cellular organisms → Bacteria538Open in IMG/M
3300005538|Ga0070731_10176270All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1419Open in IMG/M
3300005538|Ga0070731_10846182Not Available607Open in IMG/M
3300005563|Ga0068855_102097337All Organisms → cellular organisms → Bacteria569Open in IMG/M
3300005568|Ga0066703_10532625All Organisms → cellular organisms → Bacteria693Open in IMG/M
3300005993|Ga0080027_10005882All Organisms → cellular organisms → Bacteria4535Open in IMG/M
3300006806|Ga0079220_11473374All Organisms → cellular organisms → Bacteria → Acidobacteria582Open in IMG/M
3300009075|Ga0105090_10256052All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium1076Open in IMG/M
3300009088|Ga0099830_10232104All Organisms → cellular organisms → Bacteria1454Open in IMG/M
3300009137|Ga0066709_100894901All Organisms → cellular organisms → Bacteria1293Open in IMG/M
3300009524|Ga0116225_1429582All Organisms → cellular organisms → Bacteria587Open in IMG/M
3300009665|Ga0116135_1275393All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300009764|Ga0116134_1054686All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1517Open in IMG/M
3300009838|Ga0116153_10348550All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300010343|Ga0074044_10084099All Organisms → cellular organisms → Bacteria → Acidobacteria2147Open in IMG/M
3300012198|Ga0137364_11041036All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium617Open in IMG/M
3300012205|Ga0137362_11728800All Organisms → cellular organisms → Bacteria512Open in IMG/M
3300012362|Ga0137361_11149056All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300012929|Ga0137404_11941249All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium548Open in IMG/M
3300013297|Ga0157378_12497067All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium569Open in IMG/M
3300014167|Ga0181528_10542746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → unclassified Bryobacterales → Bryobacterales bacterium641Open in IMG/M
3300014169|Ga0181531_10092502All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1801Open in IMG/M
3300014495|Ga0182015_10351046All Organisms → cellular organisms → Bacteria → Acidobacteria957Open in IMG/M
3300014654|Ga0181525_10436243All Organisms → cellular organisms → Bacteria → Acidobacteria721Open in IMG/M
3300014838|Ga0182030_10985093All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia744Open in IMG/M
3300014839|Ga0182027_10368626All Organisms → cellular organisms → Bacteria1605Open in IMG/M
3300015167|Ga0167661_1058391Not Available719Open in IMG/M
3300016294|Ga0182041_11353645All Organisms → cellular organisms → Bacteria652Open in IMG/M
3300017955|Ga0187817_10509920All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae767Open in IMG/M
3300017975|Ga0187782_10975880All Organisms → cellular organisms → Bacteria → Acidobacteria658Open in IMG/M
3300017975|Ga0187782_11592475All Organisms → cellular organisms → Bacteria516Open in IMG/M
3300018037|Ga0187883_10261543All Organisms → cellular organisms → Bacteria → Acidobacteria885Open in IMG/M
3300018040|Ga0187862_10214529All Organisms → cellular organisms → Bacteria → Acidobacteria1256Open in IMG/M
3300018047|Ga0187859_10423425All Organisms → cellular organisms → Bacteria → Acidobacteria733Open in IMG/M
3300018062|Ga0187784_10813306All Organisms → cellular organisms → Bacteria → Acidobacteria745Open in IMG/M
3300020021|Ga0193726_1105450All Organisms → cellular organisms → Bacteria → Acidobacteria1272Open in IMG/M
3300021171|Ga0210405_10016708All Organisms → cellular organisms → Bacteria6022Open in IMG/M
3300021406|Ga0210386_10823418All Organisms → cellular organisms → Bacteria797Open in IMG/M
3300021560|Ga0126371_10123092All Organisms → cellular organisms → Bacteria → Acidobacteria2621Open in IMG/M
3300023068|Ga0224554_1128895All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300023091|Ga0224559_1167271All Organisms → cellular organisms → Bacteria → Acidobacteria774Open in IMG/M
3300023247|Ga0224529_1047008All Organisms → cellular organisms → Bacteria → Acidobacteria766Open in IMG/M
3300025439|Ga0208323_1078873Not Available550Open in IMG/M
3300025504|Ga0208356_1039480Not Available962Open in IMG/M
3300025506|Ga0208937_1036975Not Available1174Open in IMG/M
3300025536|Ga0207952_1030103All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria1015Open in IMG/M
3300025888|Ga0209540_10579124Not Available572Open in IMG/M
3300025914|Ga0207671_11440495All Organisms → cellular organisms → Bacteria533Open in IMG/M
3300026041|Ga0207639_10539799All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1070Open in IMG/M
3300026304|Ga0209240_1212928Not Available585Open in IMG/M
3300026377|Ga0257171_1065927All Organisms → cellular organisms → Bacteria → Acidobacteria633Open in IMG/M
3300027394|Ga0209904_1010128All Organisms → cellular organisms → Bacteria → Acidobacteria692Open in IMG/M
3300027652|Ga0209007_1169545All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300027745|Ga0209908_10173278All Organisms → cellular organisms → Bacteria → Acidobacteria579Open in IMG/M
3300027768|Ga0209772_10015411All Organisms → cellular organisms → Bacteria2131Open in IMG/M
3300027842|Ga0209580_10316558All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium777Open in IMG/M
3300027986|Ga0209168_10158055All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1147Open in IMG/M
3300028552|Ga0302149_1187804All Organisms → cellular organisms → Bacteria → Acidobacteria540Open in IMG/M
3300028779|Ga0302266_10280271All Organisms → cellular organisms → Bacteria → Acidobacteria614Open in IMG/M
3300029636|Ga0222749_10530873Not Available639Open in IMG/M
3300029636|Ga0222749_10771235All Organisms → cellular organisms → Bacteria526Open in IMG/M
3300029914|Ga0311359_10799232All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia661Open in IMG/M
3300029945|Ga0311330_11028384All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia607Open in IMG/M
3300029984|Ga0311332_11411697All Organisms → cellular organisms → Bacteria → Acidobacteria563Open in IMG/M
3300029999|Ga0311339_10418003All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE00681392Open in IMG/M
3300030057|Ga0302176_10278794All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300030225|Ga0302196_10276295Not Available779Open in IMG/M
3300030503|Ga0311370_12380616All Organisms → cellular organisms → Bacteria → Acidobacteria513Open in IMG/M
3300030617|Ga0311356_11508015All Organisms → cellular organisms → Bacteria → Acidobacteria608Open in IMG/M
3300031027|Ga0302308_10181704Not Available1362Open in IMG/M
3300031234|Ga0302325_12622170All Organisms → cellular organisms → Bacteria597Open in IMG/M
3300031235|Ga0265330_10449406Not Available547Open in IMG/M
3300031235|Ga0265330_10472577All Organisms → cellular organisms → Bacteria → Acidobacteria533Open in IMG/M
3300031241|Ga0265325_10453875All Organisms → cellular organisms → Bacteria → Acidobacteria558Open in IMG/M
3300031258|Ga0302318_10427399Not Available669Open in IMG/M
3300031525|Ga0302326_10982767All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia1188Open in IMG/M
3300031564|Ga0318573_10231225All Organisms → cellular organisms → Bacteria984Open in IMG/M
3300031708|Ga0310686_112727795All Organisms → cellular organisms → Bacteria4151Open in IMG/M
3300031941|Ga0310912_10550513All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium URHE0068898Open in IMG/M
3300032001|Ga0306922_11127269All Organisms → cellular organisms → Bacteria802Open in IMG/M
3300032160|Ga0311301_10381645All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2174Open in IMG/M
3300032160|Ga0311301_12003444Not Available676Open in IMG/M
3300032180|Ga0307471_103720826All Organisms → cellular organisms → Bacteria539Open in IMG/M
3300032342|Ga0315286_10557656All Organisms → cellular organisms → Bacteria1186Open in IMG/M
3300032401|Ga0315275_11301807Not Available787Open in IMG/M
3300032561|Ga0316222_1274416All Organisms → cellular organisms → Bacteria563Open in IMG/M
3300032783|Ga0335079_10870451All Organisms → cellular organisms → Bacteria928Open in IMG/M
3300032893|Ga0335069_11121663All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia866Open in IMG/M
3300032896|Ga0335075_10693227All Organisms → cellular organisms → Bacteria981Open in IMG/M
3300032898|Ga0335072_10384943All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium1514Open in IMG/M
3300033402|Ga0326728_10192293All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → Verrucomicrobiae → Verrucomicrobiales → Verrucomicrobia subdivision 3 → unclassified Verrucomicrobia subdivision 3 → Verrucomicrobia subdivision 3 bacterium2079Open in IMG/M
3300033405|Ga0326727_10649824All Organisms → cellular organisms → Bacteria → Acidobacteria860Open in IMG/M
3300033405|Ga0326727_10906931All Organisms → cellular organisms → Bacteria659Open in IMG/M
3300034091|Ga0326724_0370343All Organisms → cellular organisms → Bacteria770Open in IMG/M
3300034170|Ga0370487_0338234All Organisms → cellular organisms → Bacteria → PVC group → Verrucomicrobia → unclassified Verrucomicrobia → Verrucomicrobia bacterium514Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil6.93%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa6.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog5.94%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.95%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil4.95%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland3.96%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil3.96%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil3.96%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.97%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog2.97%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.97%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.97%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.97%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.98%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.98%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.98%
Thawing PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Thawing Permafrost1.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater0.99%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.99%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.99%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil0.99%
Glacier Forefield SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Glacier Forefield Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
Bog Forest SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Bog Forest Soil0.99%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.99%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.99%
Prmafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil0.99%
PalsaEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Palsa0.99%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere0.99%
Serpentinite Rock And FluidEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Serpentinite Rock And Fluid0.99%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2088090014Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004635Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3EnvironmentalOpen in IMG/M
3300004806Freshwater microbial communities from Crystal Bog, Wisconsin, USA - CBH12Aug08EnvironmentalOpen in IMG/M
3300005177Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_139EnvironmentalOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005568Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_152EnvironmentalOpen in IMG/M
3300005993Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 1 DNA2013-046EnvironmentalOpen in IMG/M
3300006806Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100EnvironmentalOpen in IMG/M
3300009075Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm March2015EnvironmentalOpen in IMG/M
3300009088Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H3.8 metaGEnvironmentalOpen in IMG/M
3300009137Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_158EnvironmentalOpen in IMG/M
3300009524Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009764Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_40EnvironmentalOpen in IMG/M
3300009838Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC028_MetaGEngineeredOpen in IMG/M
3300010343Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - Bog Forest MetaG ECP23OM1EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014167Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaGEnvironmentalOpen in IMG/M
3300014169Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaGEnvironmentalOpen in IMG/M
3300014495Permafrost microbial communities from Stordalen Mire, Sweden - 712P3M metaGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014838Permafrost microbial communities from Stordalen Mire, Sweden - 812S3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300015167Arctic soil microbial communities from a glacier forefield, Storglaci?ren, Tarfala, Sweden (Sample st-11b, vegetated hydrological feature)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017975Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300020021Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H2c1EnvironmentalOpen in IMG/M
3300021171Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-MEnvironmentalOpen in IMG/M
3300021406Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-OEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300023091Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 30-34EnvironmentalOpen in IMG/M
3300023247Peat soil microbial communities from Stordalen Mire, Sweden - C.B.S.T50EnvironmentalOpen in IMG/M
3300025439Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100 (SPAdes)EnvironmentalOpen in IMG/M
3300025504Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-1 shallow-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025506Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025536Serpentinite rock and fluid subsurface biosphere microbial communities from McLaughlin Reserve, California, USA - CR12Aug_8Ca (SPAdes)EnvironmentalOpen in IMG/M
3300025888Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes)EnvironmentalOpen in IMG/M
3300025914Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026304Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 9_17_2013_80cm (SPAdes)EnvironmentalOpen in IMG/M
3300026377Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-BEnvironmentalOpen in IMG/M
3300027394Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 712P3DEnvironmentalOpen in IMG/M
3300027652Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027745Thawing permafrost microbial communities from the Arctic, studying carbon transformations - Permafrost 812P2MEnvironmentalOpen in IMG/M
3300027768Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028552Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_1EnvironmentalOpen in IMG/M
3300028779Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E1_2EnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029914III_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029984I_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029999I_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030057Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E1_1EnvironmentalOpen in IMG/M
3300030225Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_3EnvironmentalOpen in IMG/M
3300030503III_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030617II_Palsa_N2 coassemblyEnvironmentalOpen in IMG/M
3300031027Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E3_3EnvironmentalOpen in IMG/M
3300031234Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031258Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_1EnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031941Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX080EnvironmentalOpen in IMG/M
3300032001Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.082 (v2)EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300032342Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G10_0EnvironmentalOpen in IMG/M
3300032401Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G03_0EnvironmentalOpen in IMG/M
3300032561Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18011EnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300032896Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4EnvironmentalOpen in IMG/M
3300032898Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.1EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M
3300034170Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
GPIPI_026273802088090014SoilMKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNGE
JGI12635J15846_1005616643300001593Forest SoilVKKTTISVTEAARNFADCLNRSHYQDVTFVLLKNGAP
Ga0062388_10109077623300004635Bog Forest SoilMTKVSITVTEAARNFSDCINRARYQDVTFLLLKNGSPVAE
Ga0007854_1029145913300004806FreshwaterMQTKAISVTEAARNFADCVNRVHYQNVTYVLLKNGLPFAR
Ga0066690_1095792613300005177SoilMKRTTITVTDAARNFADCVIRAHYQNVIFVLLKNGTPFARLVPHDE
Ga0070708_10201849513300005445Corn, Switchgrass And Miscanthus RhizosphereMKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNGEPVAR
Ga0070741_1157920213300005529Surface SoilMKEVSITVTEAARMFADCVNRAHYQNMAFVLTKNGKPVARLVPE
Ga0070731_1017627033300005538Surface SoilMRKLTISVTEAARNFADCVNRAHYQNITFLLVKNGSPWPD*
Ga0070731_1084618223300005538Surface SoilMKTTSISVTEAARNFSDCVSRAHYQNVTFVLLKNGAPF
Ga0068855_10209733713300005563Corn RhizosphereMAKRTISVTEAARNFADCVNRAHYQNVTFVLLKNGA
Ga0066703_1053262513300005568SoilMKKTNITVTEAARNFADCVNRVHYQNVTFVLLKNGKPFARLV
Ga0080027_1000588213300005993Prmafrost SoilMKKTSISVTEAARNFADCVNRVRYQNMSFVLLKNGS
Ga0079220_1147337413300006806Agricultural SoilMKKTGISLTEAARNFADCVNRVHYQNMTFVLLKNGEPF
Ga0105090_1025605213300009075Freshwater SedimentVITVTEAARNFAHCVNRAHYQPTTFVLLKNGKRFARL
Ga0099830_1023210443300009088Vadose Zone SoilMKKTSITVTEAARNFADCVNRVHYQNVTFVLVKNG
Ga0066709_10089490113300009137Grasslands SoilVKKTTITVTEAARNFADCVNRAHYQNVTFVLLKNGVP
Ga0116225_142958223300009524Peatlands SoilVRQTIITVTEAARNFADCVNRAHYQNVTFVLLKNGSP
Ga0116135_127539323300009665PeatlandMKTTTISVTEAARNFADCVNRVRYQNVSYVLLKNGRPV
Ga0116134_105468613300009764PeatlandMDTVAISVTEASRNFADCVNRARYQGTTFVLEKNGN
Ga0116153_1034855013300009838Anaerobic Digestor SludgeMKRKTITVTEAARNFADCVNRAHYQHTTFVLLKNGR
Ga0074044_1008409923300010343Bog Forest SoilMPKTLITVTEAARNFADCVNRAHYQNVTFVLLKNG
Ga0137364_1104103613300012198Vadose Zone SoilMKRLISVTEAARNFADCVNRVRYQNVTYVLLKNGF
Ga0137362_1172880013300012205Vadose Zone SoilMKKTAITVTQASRNFADCVNRVHYQNLTFVLLRNGRPVAHIS
Ga0137361_1114905613300012362Vadose Zone SoilMKKTTITVTEAARNFADCVNRAHYQNVTFVLLKNGV
Ga0137404_1194124913300012929Vadose Zone SoilMEKKGISVTEAARNFSECVNRVRYQNVTYVLLKNGRPVAR
Ga0157378_1249706713300013297Miscanthus RhizosphereMKKVEISVTDASRNFADCVNRVHYQNITFVLLKNGRPVARISP
Ga0181528_1054274613300014167BogMREQAISVTEAARNFSDCINRARYQGTTFILHKNGV
Ga0181531_1009250213300014169BogMEIVSISVTEASRNFADCVNRARYQGTTFILEKNG
Ga0182015_1035104613300014495PalsaMSEKAISVTEAARNFADCINRAHYQGTTFILHKNG
Ga0181525_1043624323300014654BogMETVSISVTEASRNFADCVNRARYQGTTFVLEKNGN
Ga0182030_1098509323300014838BogMKLKEISVTEAARNFAECVNQVRYQNAGFVLMKNG
Ga0182027_1036862633300014839FenMKETTITVTEAARNFADCVNRAHYQNTSFVLLKNG
Ga0167661_105839113300015167Glacier Forefield SoilMKKMAITVTVTEAARNFAHCINRVHYQNRSFVLVKNGKP
Ga0182041_1135364523300016294SoilMKKTNITVTDASRNFADCVNRAHYQNVTFILVKNGEPVARLV
Ga0187817_1050992033300017955Freshwater SedimentMKKMPISVTEAARNFADCVNRVRYQNVTFVLLKNGKPV
Ga0187782_1097588023300017975Tropical PeatlandMEIVPISVTEASRNFADCVNRARYQGTTFILEKNGNAIA
Ga0187782_1159247513300017975Tropical PeatlandMEIRPITVTEASRNFADCINRARYQGVSFLLIKGG
Ga0187883_1026154313300018037PeatlandMEVVSISVTEASRNFADCVNRARYQGTTFILEKNGVQVARI
Ga0187862_1021452933300018040PeatlandMETVSISVTEASRNFADCVNRARYQGTTFILEKNG
Ga0187859_1042342523300018047PeatlandMEIVSISVTEASRNFADCVNRARYQGTIFILEKNGVPVARIV
Ga0187784_1081330623300018062Tropical PeatlandMETQAISVTEASRNFADCVNRARYQGTSFLLLKAGEP
Ga0193726_110545013300020021SoilMKKTVISVTEAARNFADCVNRAHYQNITFVLLKNGS
Ga0210405_1001670893300021171SoilMKKTSITVTEAARNFADCVNRVHYQNMTFVLVKNGEPFARL
Ga0210386_1082341823300021406SoilMRTTAISVTEAARNFADCVNRVRYQNMSFVLLKNGTP
Ga0126371_1012309243300021560Tropical Forest SoilMKETAITVTEAARNFSEYLNRAHYQNVTFVLLKNGMPFARLMPDH
Ga0224554_112889523300023068SoilMKKHFISVTEAARNFADCVNRAHYQNVTFVLLKNGTAF
Ga0224559_116727123300023091SoilMEIVSISVTEASRNFADCVNRARYQGTTFILEKNGIP
Ga0224529_104700823300023247SoilMEIVSISVTEASRNFADCVNRAHYQGTTFILEKNGI
Ga0208323_107887323300025439PeatlandMKETTITVTEAARNFADCVNRAHYQNTTFVLLKNGKP
Ga0208356_103948023300025504Arctic Peat SoilMKKTSISVTEAARNFAHCINRVHYQNRSFVLVKNGRPLAR
Ga0208937_103697533300025506PeatlandMKTTTISVTEAARNFADCVNRAHYQNVTFVLLRNG
Ga0207952_103010333300025536Serpentinite Rock And FluidMTETTITVIEAARNLADCVNRAHYQNTTFVFLQDGVPFARLV
Ga0209540_1057912423300025888Arctic Peat SoilMKNTAITVTEAARNFAHCINRVHYQNRSFVLVKNG
Ga0207671_1144049513300025914Corn RhizosphereMKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNGEPV
Ga0207639_1053979923300026041Corn RhizosphereMKKTSITVTEASRNFADCVNRAHYQNVTFVLLKNG
Ga0209240_121292823300026304Grasslands SoilMKKSAITVTEAARNFADCVNRVHYQHISFVLLKNGKPV
Ga0257171_106592723300026377SoilMKKTSITVTEAARNFADCVNRAHYQNVTFVLLKNG
Ga0209904_101012813300027394Thawing PermafrostMKELTISVTVAARRFADCINRVRYQGTSFILHKNGVP
Ga0209007_116954513300027652Forest SoilMKEETISVTEAARNFADCVNRSHYQDVTFILLKNGE
Ga0209908_1017327823300027745Thawing PermafrostMREKVITVTEAARNFADCVNRAHYQGMTFILQKNG
Ga0209772_1001541113300027768Bog Forest SoilMKKTSLSVTEAARNFADCVNRAHYQNVTFVLLKNGKP
Ga0209580_1031655823300027842Surface SoilMKKTIISVTEAARNFAECVNRVRYQNMTFVLVKNG
Ga0209168_1015805523300027986Surface SoilMRKTEKITVTEASRNFADCVNRARYQNASFVLTKNGEAVA
Ga0302149_118780413300028552BogMEIVSISVTEASRNFADCVNRARYQGTTFVLEKNGNPV
Ga0302266_1028027113300028779BogMSEKVISVTEAARNFADCVNRTRYQGTTFVLHKNG
Ga0222749_1053087323300029636SoilMKRKTITVTEAARNFGNYVNRAHYQNTTFVLLKNGRPFGCG
Ga0222749_1077123523300029636SoilMKKTNITVTEAARNFADCVNRVHYQNVSFVLLKNGEPFAR
Ga0311359_1079923223300029914BogMPDRNISVTEAARNFSDCVNRAHYQATTFILLKNG
Ga0311330_1102838413300029945BogMKKVISVTEAARNFADCVNRAHYQNVTFVLLKNGAP
Ga0311332_1141169723300029984FenMRELVISVTQAARRFADCINRVRYQNTSFVLHRNGVP
Ga0311339_1041800313300029999PalsaMKEKVITVTEAARNFAECVNRTHYQGMTFILHKNGVP
Ga0302176_1027879423300030057PalsaMKTTTISVTDAARNFADCVNRVHYQNVSYVLLKNGKPVAR
Ga0302196_1027629523300030225BogMSTKAITVTEAARNFADCVNRVRYQGTTFVLQKNGVPV
Ga0311370_1238061623300030503PalsaVDEKAISVTEAARNFADCINRAHYQGVTFILHKNG
Ga0311356_1150801523300030617PalsaMKTTPISVTEAARNFADCVNRVRYQNVSFVLLKNGRPVA
Ga0302308_1018170423300031027PalsaMSEKAITVTEAARNFADCVNRVRYQGTTFVLHKNGVPVA
Ga0302325_1262217023300031234PalsaMKTTAISVTEAARNFADCVNRVRYQNVTFVLLKNGTPRGASSSGE
Ga0265330_1044940613300031235RhizosphereMKETAITVTEAARNFSDCLNRAHYQNMSFVLLKNGKPFAR
Ga0265330_1047257723300031235RhizosphereMKELVISVTQAARRFSDCVNRVRYQGTSFVLQKNGV
Ga0265325_1045387523300031241RhizosphereMKELTISVTQAARRFADCVNRVRYQGTSFVLHKNGVPVAR
Ga0302318_1042739923300031258BogMSERIITVTEAARNFADCINRARYQGTTFVLQKNGLP
Ga0302326_1098276723300031525PalsaMIKTTISVTEASRNFADCVSRAHYQNVTFVLLKNGVP
Ga0318573_1023122513300031564SoilMKKTSITVTDASRNFADCVNRAHYQKITFVLLKNG
Ga0310686_11272779543300031708SoilMKKTSITVTEASRNFAECVNRAHYQKVTFVLLKNGEPV
Ga0310912_1055051313300031941SoilMKKTISISVTDAARNFSDCINRVRYQGVSFVLHKNGVPVAR
Ga0306922_1112726923300032001SoilMKKRSITVTEASRNFAECVNRAHYQNVTFVLLKNGE
Ga0311301_1038164513300032160Peatlands SoilMETHAISVTEASRNFADFVSRARYQGTSFLLLKEGEPVAR
Ga0311301_1200344413300032160Peatlands SoilMRTTTINVTEAARNFADCVNRAHDQNVSIVLLKNGLPFARLVPE
Ga0307471_10372082613300032180Hardwood Forest SoilMRKTNISVTEAARNFADCVNRAHYQNVTFVLLKNGEPF
Ga0315286_1055765623300032342SedimentMKETTITVTEAARNFSDCVNRARYQHVTFVLVKNGRPV
Ga0315275_1130180713300032401SedimentMKETTITVTEAARNFSDCVNRARYQHVTFVLVKNGRP
Ga0316222_127441613300032561FreshwaterMQKANISVTEAARNFADCVNRAHYQNVTFILLKNG
Ga0335079_1087045113300032783SoilMHKTIITVTQAARHFADCVNRAHYQNVTFVLVKNGSPV
Ga0335069_1112166313300032893SoilMKETTITVTEAARSFAECVNRAHYQRTTFVLLKNGRPFARIE
Ga0335075_1069322723300032896SoilMRRIAITVTKAVRSFADCINRVHYQDVTFVLLKNGTAVAELAP
Ga0335072_1038494313300032898SoilMRSVSISVTEAARNFADCINRVRYQGISFILHRNG
Ga0326728_1019229323300033402Peat SoilMKEKTITVTEAARNFADCVNRAHYQHTTFVLLKNG
Ga0326727_1064982423300033405Peat SoilMETVSISVTEASRNFADCVNRARYQDVSFILLKNGNP
Ga0326727_1090693123300033405Peat SoilMKKAVITVTEAARNFAHCVNRAHHQNTSFVLLQNGKPA
Ga0326724_0370343_3_1073300034091Peat SoilMREKAISVTEAARNFADCVNRAHYQGMTFVLYKNG
Ga0370487_0338234_1_1233300034170Untreated Peat SoilMRSKIITVTEAARNFADCVNRVRYQNCAFTLVKNGTPVASL

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.