NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F102943

Metagenome Family F102943

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F102943
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 113 residues
Representative Sequence MSDWLRSGCVSVALLAASAACSAPAWAQGERCGAGKDLVVQALERITPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPLV
Number of Associated Samples 82
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 47.78 %
% of genes near scaffold ends (potentially truncated) 87.13 %
% of genes from short scaffolds (< 2000 bps) 81.19 %
Associated GOLD sequencing projects 81
AlphaFold2 3D model prediction Yes
3D model pTM-score0.71

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (89.109 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog
(19.802 % of family members)
Environment Ontology (ENVO) Unclassified
(64.356 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(40.594 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 60.14%    β-sheet: 0.00%    Coil/Unstructured: 39.86%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.71
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
a.118.8.1: Tetratricopeptide repeat (TPR)d2vyia_2vyi0.76927
a.118.8.0: automated matchesd4gcoa_4gco0.75959
a.118.8.1: Tetratricopeptide repeat (TPR)d1a17a_1a170.75784
a.118.8.1: Tetratricopeptide repeat (TPR)d1w3ba_1w3b0.75592
a.118.1.30: FAT domaind4jspa34jsp0.75254


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF08335GlnD_UR_UTase 1.98
PF06552TOM20_plant 1.98
PF03445DUF294 0.99
PF13205Big_5 0.99
PF06969HemN_C 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG1391Glutamine synthetase adenylyltransferasePosttranslational modification, protein turnover, chaperones [O] 1.98
COG2844UTP:GlnB (protein PII) uridylyltransferaseSignal transduction mechanisms [T] 1.98
COG0635Coproporphyrinogen-III oxidase HemN (oxygen-independent) or related Fe-S oxidoreductaseCoenzyme transport and metabolism [H] 0.99
COG2905Signal-transduction protein containing cAMP-binding, CBS, and nucleotidyltransferase domainsSignal transduction mechanisms [T] 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms89.11 %
UnclassifiedrootN/A10.89 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002245|JGIcombinedJ26739_100228169All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1753Open in IMG/M
3300006795|Ga0075520_1267072All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii709Open in IMG/M
3300009621|Ga0116116_1146611All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii622Open in IMG/M
3300009631|Ga0116115_1101855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii736Open in IMG/M
3300009644|Ga0116121_1106209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii881Open in IMG/M
3300009644|Ga0116121_1269827All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii546Open in IMG/M
3300009646|Ga0116132_1138428All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii743Open in IMG/M
3300009762|Ga0116130_1033327All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1666Open in IMG/M
3300014151|Ga0181539_1245279All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii671Open in IMG/M
3300014160|Ga0181517_10343469All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii775Open in IMG/M
3300014160|Ga0181517_10535330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii590Open in IMG/M
3300014162|Ga0181538_10204971All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1105Open in IMG/M
3300014164|Ga0181532_10261304All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii991Open in IMG/M
3300014165|Ga0181523_10753155All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii531Open in IMG/M
3300014201|Ga0181537_10802310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii639Open in IMG/M
3300014499|Ga0182012_10709457All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii641Open in IMG/M
3300014638|Ga0181536_10311725All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii728Open in IMG/M
3300014658|Ga0181519_10189998All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1297Open in IMG/M
3300017929|Ga0187849_1325712All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii571Open in IMG/M
3300017931|Ga0187877_1038771All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2282Open in IMG/M
3300017931|Ga0187877_1206574All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii769Open in IMG/M
3300017931|Ga0187877_1237271All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii706Open in IMG/M
3300017941|Ga0187850_10182918All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii967Open in IMG/M
3300017988|Ga0181520_10755403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii659Open in IMG/M
3300018002|Ga0187868_1153738All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii833Open in IMG/M
3300018014|Ga0187860_1311330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii607Open in IMG/M
3300018016|Ga0187880_1249473All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii783Open in IMG/M
3300018023|Ga0187889_10308746All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii698Open in IMG/M
3300018030|Ga0187869_10204482All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii966Open in IMG/M
3300018030|Ga0187869_10323241All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii740Open in IMG/M
3300018033|Ga0187867_10261264All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii974Open in IMG/M
3300018043|Ga0187887_10268733All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1008Open in IMG/M
3300018044|Ga0187890_10040329All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2810Open in IMG/M
3300018044|Ga0187890_10367061All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii807Open in IMG/M
3300018047|Ga0187859_10734863All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii563Open in IMG/M
3300018057|Ga0187858_10734837All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii587Open in IMG/M
3300023090|Ga0224558_1067531All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1366Open in IMG/M
3300025412|Ga0208194_1028382All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii887Open in IMG/M
3300025473|Ga0208190_1017263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1715Open in IMG/M
3300025507|Ga0208188_1126790All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii555Open in IMG/M
3300025576|Ga0208820_1143532All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii543Open in IMG/M
3300028560|Ga0302144_10154458All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii742Open in IMG/M
3300028560|Ga0302144_10166901All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii712Open in IMG/M
3300028765|Ga0302198_10308084All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii743Open in IMG/M
3300028765|Ga0302198_10513784All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii534Open in IMG/M
3300028766|Ga0302269_1190411All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii578Open in IMG/M
3300028785|Ga0302201_10155314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii979Open in IMG/M
3300028800|Ga0265338_10271667All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1242Open in IMG/M
3300028800|Ga0265338_10622263All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii750Open in IMG/M
3300029883|Ga0311327_10301177All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1042Open in IMG/M
3300029911|Ga0311361_10752337All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii877Open in IMG/M
3300029915|Ga0311358_11090659All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii540Open in IMG/M
3300029919|Ga0302141_1153744All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii623Open in IMG/M
3300029939|Ga0311328_10605402All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii754Open in IMG/M
3300029954|Ga0311331_11354384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii589Open in IMG/M
3300029956|Ga0302150_10019756All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2686Open in IMG/M
3300029986|Ga0302188_10451588All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii524Open in IMG/M
3300029988|Ga0302190_10036453All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2513Open in IMG/M
3300029988|Ga0302190_10420566All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii505Open in IMG/M
3300029993|Ga0302304_10167500All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii823Open in IMG/M
3300029993|Ga0302304_10207996All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii725Open in IMG/M
3300030020|Ga0311344_10040768All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii5911Open in IMG/M
3300030044|Ga0302281_10342442All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii587Open in IMG/M
3300030047|Ga0302286_10184474All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1055Open in IMG/M
3300030051|Ga0302195_10177356All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii998Open in IMG/M
3300030054|Ga0302182_10111557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1197Open in IMG/M
3300030618|Ga0311354_10062141All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii4289Open in IMG/M
3300030618|Ga0311354_10451210All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1284Open in IMG/M
3300030688|Ga0311345_11022027All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii619Open in IMG/M
3300030906|Ga0302314_10498915All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1309Open in IMG/M
3300031028|Ga0302180_10567856All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii549Open in IMG/M
3300031239|Ga0265328_10243011All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii688Open in IMG/M
3300031247|Ga0265340_10240518All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii808Open in IMG/M
3300031344|Ga0265316_11074870All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii558Open in IMG/M
3300031344|Ga0265316_11146459All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii538Open in IMG/M
3300031521|Ga0311364_10157465All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii2352Open in IMG/M
3300031788|Ga0302319_11191340All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii705Open in IMG/M
3300031837|Ga0302315_10193366All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1229Open in IMG/M
3300031918|Ga0311367_11981122All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii562Open in IMG/M
3300032783|Ga0335079_11216083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii757Open in IMG/M
3300033402|Ga0326728_10674557All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii783Open in IMG/M
3300033405|Ga0326727_10053095All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii6309Open in IMG/M
3300033405|Ga0326727_10638872All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii872Open in IMG/M
3300033405|Ga0326727_10726236All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii786Open in IMG/M
3300033405|Ga0326727_10988214All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii616Open in IMG/M
3300033405|Ga0326727_11055376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii585Open in IMG/M
3300033755|Ga0371489_0160782All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii1210Open in IMG/M
3300033977|Ga0314861_0236203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii848Open in IMG/M
3300034065|Ga0334827_118410All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii853Open in IMG/M
3300034130|Ga0370494_081005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Candidatus Sulfotelmatomonas → Candidatus Sulfotelmatomonas gaucii819Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog19.80%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland18.81%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland11.88%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog9.90%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa7.92%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil7.92%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere7.92%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen3.96%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil0.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.99%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.99%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland0.99%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.99%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300006795Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostAB12-BEnvironmentalOpen in IMG/M
3300009518Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_150EnvironmentalOpen in IMG/M
3300009521Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaGEnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009631Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_100EnvironmentalOpen in IMG/M
3300009644Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009760Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_100EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300014151Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014162Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_30_metaGEnvironmentalOpen in IMG/M
3300014164Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014201Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin23_10_metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014658Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaGEnvironmentalOpen in IMG/M
3300017929Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_100EnvironmentalOpen in IMG/M
3300017931Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_100EnvironmentalOpen in IMG/M
3300017935Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_40EnvironmentalOpen in IMG/M
3300017941Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_4_150EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018002Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_40EnvironmentalOpen in IMG/M
3300018014Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_40EnvironmentalOpen in IMG/M
3300018016Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_40EnvironmentalOpen in IMG/M
3300018023Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018030Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018043Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_10EnvironmentalOpen in IMG/M
3300018044Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_21_10EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300018090Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP02_20_MGEnvironmentalOpen in IMG/M
3300023090Peat soil microbial communities from Stordalen Mire, Sweden - 717 S3 20-24EnvironmentalOpen in IMG/M
3300025412Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_19_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025473Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025576Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_40 (SPAdes)EnvironmentalOpen in IMG/M
3300028560Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_2EnvironmentalOpen in IMG/M
3300028765Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N2_2EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300028785Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_2EnvironmentalOpen in IMG/M
3300028800Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaGHost-AssociatedOpen in IMG/M
3300029883I_Bog_E2 coassemblyEnvironmentalOpen in IMG/M
3300029911III_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029915III_Bog_E1 coassemblyEnvironmentalOpen in IMG/M
3300029919Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E1_2EnvironmentalOpen in IMG/M
3300029939I_Bog_E3 coassemblyEnvironmentalOpen in IMG/M
3300029954I_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300029956Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_2EnvironmentalOpen in IMG/M
3300029986Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_1EnvironmentalOpen in IMG/M
3300029988Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_E2_3EnvironmentalOpen in IMG/M
3300029993Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_E2_2EnvironmentalOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030044Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E1_2EnvironmentalOpen in IMG/M
3300030047Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_E2_3EnvironmentalOpen in IMG/M
3300030051Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N1_2EnvironmentalOpen in IMG/M
3300030054Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_1EnvironmentalOpen in IMG/M
3300030618II_Palsa_E3 coassemblyEnvironmentalOpen in IMG/M
3300030688II_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030906Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N2_3EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031239Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaGHost-AssociatedOpen in IMG/M
3300031247Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaGHost-AssociatedOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031521III_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300031708FICUS49499 Metagenome Czech Republic combined assemblyEnvironmentalOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031837Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N3_1EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300032783Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033977Tropical peat soil microbial communities from peatlands in Loreto, Peru - SJ75EnvironmentalOpen in IMG/M
3300034065Peat soil microbial communities from Stordalen Mire, Sweden - 714 S1 1-5EnvironmentalOpen in IMG/M
3300034130Peat soil microbial communities from wetlands in Alaska, United States - Collapse_03_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGIcombinedJ26739_10022816913300002245Forest SoilMNSCRRSILACLPLLFATLIAAPSSRAQGIRCGAGQDLIVQALEQITPQSDTKAFGDALELLKSALGECPELGDAWYYRSLVEKRLGHQALADYAMGKARFNGSDALDQGLDPLVLATPASRGIEAEGVETP
Ga0075520_126707223300006795Arctic Peat SoilMKRSRSIRFAWLVMLAASVMICAPAWGQEQRCGAGKDLVVQALERISPQSDNSAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHETLARYAMDKARFNGSEALQQGLNPLVLATPAGRGFAV
Ga0116128_113482123300009518PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDK
Ga0116222_124365523300009521Peatlands SoilMKSFRRFGFLVLAFLTAALVPSPRSQAQGVRCGAGQDLVVQALERITPQSGDDAFQDALELLKHAVAECPELGDAWYYRSLVEKRLGHANLANYA
Ga0116116_114661113300009621PeatlandMSDWLRSGCVSVALLAASAACSAPAWAQGERCGAGKDLVVQALERITPQSDDGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPL
Ga0116115_110185513300009631PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLSTPA
Ga0116121_110620923300009644PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALDQGLNPLVLSTP
Ga0116121_126982713300009644PeatlandMSDWLRSGCVSVALLAASAACSAPAWAQGERCGAGKDLVVQALERITPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPLV
Ga0116132_113842813300009646PeatlandMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLST
Ga0116131_122019923300009760PeatlandMTLRIRFVAAILALLTATLFAHPRAAAQGIRCGAGQDLVVQALERITPQSGNDAFQDALELLKHAVSECPELGDAWYYRSLVEKRLGHEALANYSLDKARF
Ga0116130_103332713300009762PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEALDQGLNPLVLST
Ga0181539_124527913300014151BogMILRGRSLLVILPLLAATLLASPCARAQGIRCGAGQDLIVQALERITPQGGNDAFEDALQLLKSALAECPELGDAWYYRSLVEKRLGHDSLAKYAMDKARFNGSEALDQDLNPLV
Ga0181517_1034346913300014160BogMNSRTRSELAILSLLAATLVASPRARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDSLANYAMDKARFNGSDALDQNLNPLVLSTPASRGIEAEGTETPVPVA
Ga0181517_1053533013300014160BogMLFGAMTWAGSPSWGQSERCGAGTDLVVQALERVTPQSDSSAFEDALQLLKHAVSECGELGDAWYYRSLVEQKLGHDALAKYALDKARLTGSEAL
Ga0181538_1020497113300014162BogMSHWLKLGCAYAALMAAWAGFSAPAWGQGERCGAGKDLVVQALERIAPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGS
Ga0181532_1026130423300014164BogMISPTRSRLALLPLLAATMIACPGVRAQGVRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEAEGTET
Ga0181523_1075315513300014165BogMSNWLRSGCLSAALLAASAGCCLPACGQGERCGAGKDLVVQALERITPQSGNSAFEDALQLLKHAISECSELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQ
Ga0181537_1080231023300014201BogMILRSRSRLDLLPLLAAALIACPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNGSEALDQGL
Ga0182012_1070945723300014499BogMMSSRGIRIALFALLLVLTGTGSSARGQGVRCGAGKDLVVQALERISPQSGNSAFEDALQLLKHAVQECSELGDAWYYRSLVEQRLGHDSLAKYAMEKARFNGSEALEQGLNPMILATPPSRGFAVDE
Ga0181536_1031172523300014638BogMSDWLRIGCLSVALLAASAGCSAPTWAQGERCGAGKDLVVQALERIAPQSDSGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNP
Ga0181519_1018999823300014658BogMSGCRPIRIAFGPIRIAAWILLAATAWAGSSAWGQAERCGAGKDLVVQALERATAQSDSSAFADALQLLKHAVSECGELGDAWYYRSLVEQKLGHDALAKYALDKARLTGSEALE
Ga0187849_132571223300017929PeatlandMSGCRPSRLAFGPIRIAAWILLAAAAWVVPSAWGQAERCGAGKDLVVQALERATAQSDSSAFADALQLLKHAVSECGELGDAWYYRSLVEQKLGHDALAKYALDKARLTGSEALEQ
Ga0187877_103877113300017931PeatlandMISPSRSRLALLPLLAAALIACPSARAQGARCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKHLGHDSLANYAMDKARFNSSEAL
Ga0187877_120657413300017931PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSTPASRG
Ga0187877_123727123300017931PeatlandMSHWLKLGCAYAALMAAWAGFSAPAWGQGERCGAGKDLVVQALERIAPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVERRLGHDALAKYAMDKARFTGSEALAQGLNP
Ga0187848_1007766613300017935PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAM
Ga0187850_1018291813300017941PeatlandMSDWLRSGCVSVALLAASAACSAPAWAQGERCGAGKDLVVQALERITPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARF
Ga0181520_1075540323300017988BogMSNCWPRRLVLLALLAGVAIISRSAWGQGERCGAGKDLVVQALERITPQSDNSAFEDALQLLKHAVSVCGELGDAWYYRSLVEQRLGHDALAKYAMDKARFNRSEALQEGL
Ga0187868_115373813300018002PeatlandMSGSLRLRIASCMLLAIVAGVASSAWGQGERCGAGRDLVVQALERITPQSDNRAFEDALQPLKHAVSECGELGDAWYYRSLVEQRLGHDSLAKYAVDKARLTGSEALQQGLNPLV
Ga0187860_131133023300018014PeatlandMSGSLRLRIASCMLLAIVAGVASSAWGQGERCGAGRDLVVQALERITPQSDNGAFEDALQLLKQAVQECSELGDAWYYRSLVEKRLGHDALAKYA
Ga0187880_124947313300018016PeatlandMSNWLRSGCLSAALLAASAGCCLPACGQGERCGAGKDLVVQALERITPQSGNSAFEDALQLLKHAISECSELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPLVLATPARRGLAAEGDETSAPAAPA
Ga0187889_1030874613300018023PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLVLSAPASRGIEAEGTETPVHRSFGALSLNAAR
Ga0187857_1017271423300018026PeatlandMSSRSPSSLAILALFTAALFAYPRASAQGIRCGAGQDLVVQALELIAPQSGDDAFEDALQLLKAAVAECPELGDAWYYRSLVEKRLGHDSLAKYALD
Ga0187869_1020448223300018030PeatlandMSDWLRSGCVSVALLAASAACSAPAWAQGERCGAGKDLVVQALERITPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPLVLATPARRGLAA
Ga0187869_1032324123300018030PeatlandMSRARFASAAMLAAIVLCSTHAVAQDSRCGAGRDLVVQALERISPQSDRGAFEDALQLLKHAVSECGELGDAWYYRSLVEQRLGHDSLAHYAMDKARFVGAEALQQQLNPLILSTPSTRGISVEAGAPQAAQPAPSK
Ga0187867_1026126413300018033PeatlandMSHWLKLGCAYAALMAAWAGFSAPAWGQGERCGAGKDLVVQALERIAPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQ
Ga0187887_1026873323300018043PeatlandMSRARFASAAMLAAIVLCSTHAVAQDSRCGAGRDLVVQALERISPQSDRGAFEDALQLLKHAVSGCGELGDAWYYRSLVEQRLGHDSLAHYAMDKARFVGSEALQQELNPLI
Ga0187890_1004032933300018044PeatlandMISPTRSRLALLPLLAATMIACPGVRAQGVRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALDQGLNPLVLSTPASRGFEA
Ga0187890_1036706113300018044PeatlandMRNFGPRRLMFLALLAGVASLCPSAWGQAERCGAGRDLVVQALERITPQSDRSAFEDALQLLKHAVSVCGELGDAWYYRGLVEQRLGHDALAKYAMDKARFNGSEALQQGLNPL
Ga0187859_1073486323300018047PeatlandMSHWLKLGCAYAALMAAWAGFSAPAWGQGERCGAGKDLVVQALERIAPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPLVLATPARRGLAA
Ga0187858_1073483723300018057PeatlandMSNCWPRRLVFLALMAGVASTCPSARGQAERCGAGRDLVVQALERISPQSDRSAFEDALQLLKHAVSVCGELGDAWYYRGLVERRLGHDALA
Ga0187770_1082558423300018090Tropical PeatlandMIARMRCFSAIAALLAAALGAHPCATAQGIRCGAGQDLVIQALERITPQSGNEAFEDALQLLKSALGECPELGDAWYYRSLVEKRLGHDALANYAMDK
Ga0224558_106753113300023090SoilMSSCRQSRLVCLAMLAAAASVCSPARGQGERCGAGRDLVVQALERITPQSDNSAFEDALQLLKHAVSECGELGDAWYYRSLVEQRLGHDALARYAMDKARFTGSEALQQGLNPLVLATPARRGLIAEGDATKTPGA
Ga0224558_122830013300023090SoilMGFCRFRNAPLVLFTALLGFCPCVHAQGIRCGAGQDLVVQALERVTPQSGDDAFEDALELLKHAVAECPELGDAWYYRSLVEKRLGHTALANYSLD
Ga0208194_102838223300025412PeatlandMNSRTRSGLAILSLLAATLIASPCARAQGIRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALAKYAMDKAHFNGSEALDQDLNPLV
Ga0208190_101726313300025473PeatlandMSHWLKLGCAYAALMAAWAGFSAPAWGQGERCGAGKDLVVQALERIAPQSDNGAFEDALQLLKHAISECGELGDAWYYRSLVEKRLGHDALAKYALDKARFNGSEALDQGLNPLE
Ga0208188_112679013300025507PeatlandMSDWLRIGCLSVALLAASAGCSAPTWAQGERCGAGKDLVVQALERIAPQSDSGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKARFTGSEALAQGLNPLVLATPARRGLAAEPDETGVPP
Ga0208820_114353223300025576PeatlandMSDWLRIGCLSVALLAASAGCSAPTWAQGERCGAGKDLVVQALERIAPQSDSGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALA
Ga0302144_1015445813300028560BogMRNSWPSRLVCLVILTTAAVVCSPASAQGARCGAGKDLVVQALERITPQGDNNAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFNGSEALQQ
Ga0302144_1016690123300028560BogMKPLMRIVAFALLAAFCAQARAADDRCGAGKDLVVQALERISPTSDRGAFEDALQLLKHAVEECSELGDAWYYRSLVEQKLGHDALAKYAMDKARFNTSEALEQGLNP
Ga0302198_1030808423300028765BogMKPLMRIAAFALLAAFCAQARAADDRCGAGKDLVVQALERISPTSDRGAFEDALQLLKHAVEECSELGDAWYYRSLVEQKLGHDALAKYAMDKARFNTSEALEQGL
Ga0302198_1051378413300028765BogMKCARCVAAIGMLVVSACCCTQARAADDRCGAGKDLVVQALERISPASDNGTYQDALQLLKHALEECSELGDAWYYRSLMEQRLGHDALAKYALDKARFNGSEAMQQG
Ga0302269_119041113300028766BogMRNSWPSRLVCLVILTTAAVVCSPASAQGTRCGAGKDLVVQALERITPQGDNNAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFNGSEALQQALNPLVLATPASR
Ga0302201_1015531423300028785BogMRNRWPSRVVCLALLAAAASVCSSAWGQGDRCGAGKDLVVQALERISPQSDQSAFEDALQLLKHAVSECGELGDGWYYRSLVEQRLGHDA
Ga0265338_1027166723300028800RhizosphereMRLPHACALAAIALFSSLQASCQDARCGAGKDLVVQALERISPQANQSAFEDALQLLKHAVSECGELGDAWYYRSLVEQKLGHDSLAKYALDKARFLGSEAMQEQLNPLLLATPSSRGITAEPEAGPAPVPVAA
Ga0265338_1062226313300028800RhizosphereMISPTRSRLAVFSLLAATLIACPCARAQGVRCGAGHDLIVQALERITPQSGNGAFVDALELLKSALSECPELGDAWYYRSLVEKRLGHDSLADYAMGKARFNGSDALDQGLNPLILSTPASRGFEAEGPQTPVPAA
Ga0311327_1030117723300029883BogMRTLRIAFIGTLAICSCASAWGQGERCGAGKDLVVQALERITPESDRGAFEDALQLLKHAVSTCAELGDAWYYRSVIEQRLGHDALAKYALDKARFNGSEAMQQG
Ga0311361_1075233723300029911BogMKGLRLIRIQWLMVLAASSVLCVPALGEDDRCGAGKDLVVQALERISPNGNNNAFENALQLLKHAVQECSELGDAWYYRGLVEQRLGHDALAKYSMDKARFNDSEALQQGLNPLV
Ga0311358_1109065923300029915BogMTSSRIIRFAWLVLLAALPAICTSAWGQDDQCGAGKDLVVQALERISPQSNNGAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYSMDKARFNGSEAL
Ga0302141_115374423300029919BogMRNRWPSRVVCLALLAAAASVCSSAWGQGDRCGAGKDLVVQALERISPQSDQSAFEDALQLLKHAVSECGELGDG
Ga0311328_1060540223300029939BogMKPRMRIAACALLAAFCAQARAADDRCGAGKDLVVRALERISPTSDRGAFEDALQLLKHAVEECSELGDAWYYRSLVEQKLGHDALAKYAMDKARFNTSDALEQGLNPLVLA
Ga0311331_1135438423300029954BogMNRAPFASGAMLAAIVLCSTHAVAQDSRCGAGRDLVVQALERISPQSDRGAFEDALQLLKHAVSECGELGDAWYYRSLVEQRLGHDSLAHYAMDKARFVGSEALQQELNPLILSTPSTR
Ga0302150_1001975613300029956BogMRRVRLAFLAALAVCLCSTAWGQGERCGAGKDLVVQALERISPEADRSAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFTNSEALQQGLNPLVLATPAGRGFA
Ga0302188_1045158813300029986BogMRNRWPSRVVCLALLAAAASVCSSAWGQGDRCGAGKDLVVQALERISPQSDQSAFEDALQLLKHAVSECGELGDGWYYRSLVEQRLGHDALAKYAMDKARFTGSEALRQGLNPLVLATPAGRGL
Ga0302190_1003645313300029988BogMRRVRLAFLAALAVCLCSTAWGQGERCGAGKDLVVQALERISPEADRSAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFTNSEALQ
Ga0302190_1042056613300029988BogMKPLMRIAAFALLAAFCAQARAADDRCGAGKDLVVQALERISPTSDRGAFEDALQLLKHAVEECSELGDAWYYRSLVEQKLGHDALAKYAMDKARFNT
Ga0302304_1016750013300029993PalsaMKNCYTAIFAAVLVCVPAWGQGPRCGAGKDLVVQALERVTPQSDRGAFEDALQLLKHAVSECSELGDAWYYRSLMEQRLGHDALAKYALDKARFNGSEALQQGL
Ga0302304_1020799613300029993PalsaMRLRSARSRAGSAHWLCVPAWGQGERCRDGKDLVGQALERVTRQCDRSAFEDALQLLKHAVSECSELGDAWYYRSLMEQRLGHEALAKYALAKARFNGSEA
Ga0311344_1004076813300030020BogMRNRWPSRVVCLALLAAAASVCSSAWGQGDRCGAGKDLVVQALERISPQSDQSAFEDALQLLKHAVSECGELGDGWYYRSLVEQRLGHDALAKYAMDKARFTGSEALRQGLNPLVLATPAGRGLVAEGDETK
Ga0302281_1034244223300030044FenMRRVRLAFLAALAVCLCSTAWGQGERCGAGKDLVVQALERISPEADRSAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFTNSEALQQGLNPLVLATPAGRGFAAVAKSADASGAKQPATQ
Ga0302286_1018447413300030047FenMKKRECIRYALFVLAMVLACCCAPARGEDDRCGAGKDLVVRALERVTPQSDNGAFEDALQLLKHAVQECSELGDAWYYRSLVEKRLGHDAQAKYAMDKARFNGSEAMQQGLNPLMLA
Ga0302195_1017735613300030051BogMRNRWPSRVVCLALLAAAASVCSSAWGQGDRCGAGKDLVVQALERISPQSDQSAFEDALQLLKHAVSECGELGDGWYYRSLVEQRLGHDAL
Ga0302182_1011155713300030054PalsaMNRAPFASGAMLAAIVLCSTHAVAQDSRCGAGRDLVVQALERISPQSDRGAFEDALQLLKHAVSECGELGDAWYYRSLVEQRLGHDSLAHYAMDKARFVGSEALQQELNPLILSTPSTRG
Ga0311354_1006214133300030618PalsaMKMLLRACAFFLAGCACVPAGAQGPRCGAGRDLIVQALERVTPQSERGAFEDALQLLKHAVSECNELGDAWYYRSLVEQRLGHDALAKYAMDKARFNGSEALDQGLNPFVLATPAGRGFADLGKP
Ga0311354_1045121013300030618PalsaMKNCYTAIFAAVLVCVPAWGQGPRCGAGKDLVVQALERVTPQSDRGAFEDALQLLKHAVSECSELGDAWYYRSLMEQRLGHDALAKYALDKARFNGSEALQQGLNPLMLATPSERGFAAVAKPGDSSGA
Ga0311345_1102202713300030688BogMRSRGIAFVAAFSACLCVPVWGQGERCGAGKDLVVQALERVTPQSDRSAFEDALQLLKHAVSECSELGDAWYYRSLMEQRLGHDALAKYALDKARFNGSEALQEGLNPLM
Ga0302314_1049891513300030906PalsaMKMLLRACAFFLAGCACVPAGAQGPRCGAGRDLIVQALERVTPQSERGAFEDALQLLKHAVSECNELGDAWYYRSLVEQRLGHDALAKYAMEKARFNGSEALDQGLNPFVLATPAGRGFVDLGKPGE
Ga0302180_1056785623300031028PalsaMKNCYTAIFAAVLVCVPAWSQGPRCGAGKDLVVQALERVTPQSDRGAFEDALQLLKHAVSECSELGDAWYYRSLMEQRLGHDALAKYALDKARFNGSEALQQGLNPLMLATPSERGF
Ga0265330_1006383413300031235RhizosphereMNSYTRSGLAILSLLAATLVASPCARAQGIRCGAGQDLIIQALERITPQSDNKAFGDALELLKSALSECPELGDAWYYRSLVEKRLGHDSLATYAMGKARFNGSEAL
Ga0265328_1024301113300031239RhizosphereVLAALSGVCTVAHGQEQRCGAGKDLVVQALERITPQSENSAFEDALQLLKHAVSECSELGDAWYYRSLVEQHLGHDTQAKYAMEKARFNGSEAMQQGLNPLVLA
Ga0265340_1024051813300031247RhizosphereMKMFQFTCIAPLILLVSLASHCVPAAGEDNRCGAGKDLVVRALERITPQSGTAGFEDALQLLKHAVQECSELGDAWYYRGLVEQRLGHDAQAKYAMDKA
Ga0265316_1107487013300031344RhizosphereMRICWPSRLMCLALLAGVASICPSAWGQAERCGAGKDLVVQALERVTPQSDNRAFEDALQLLKHAASVCGELGDAWYYRSLVEQRLGHDALAKYAMDKARFNGSEALQQGLNPLALATPAGRGIVAEG
Ga0265316_1114645923300031344RhizosphereMKIYRFNEARILVVLAALSGVCTVAHGQEQRCGAGKDLVVQALERITPQSENSAFEDALQLLKHAVSECSELGDAWYYRSLVEQHLGHDTQAKYAMEKARFNGSEAMQQGLN
Ga0311364_1015746533300031521FenMKKRECIRYALFVLAMVLACCCAPARGEDDRCGAGKDLVVRALERVTPQSDNGAFEDALQLLKHAVQECSELGDAWYYRSLVEKRLGHDAQAKYAMDKARFNGSEAMQQGLNPLV
Ga0310686_11856572723300031708SoilMNTCRRSILVCLPLLFATLVAATSTRAQGVRCGAGQDLIVQALEQITPQSGNDAFENALQLLKSAVAECPELGDAWYYRSLVEKRLGRGHEAFASYAMDKARFN
Ga0265342_1046985723300031712RhizosphereMKRYRRMRFVSLFVLAVLACSCAAVSGEDDRCGAGKDLVVQALERITPQSENGAFEDALQLLKHAVQECSELGDAWYYRSLVEKRLGHDTQAKYAMDKARFNGSEAMQQGLNPLVLATPAGRGFAAEEGTAKAPGTSAA
Ga0302319_1119134023300031788BogMNRAPFASGAMLAAIVLCSTHAVAQDSRCGAGRDLVVQALERISPQSDRGAFEDALQLLKHAVSECGELGDAWYYRSLVEQRLGHDSLAHYAMDKARFVGSEALQQELNPLILSTPSTRGFAVE
Ga0302315_1019336623300031837PalsaMKMLLRACAFFLAGCACVPAGAQGPRCGAGRDLIVQALERVTPQSERGAFEDALQLLKHAVSECNELGDAWYYRSLVEQRLGHDALAKYAMEKARFNGSEALDQGLNPFVLATPAGRGFVDLGKP
Ga0311367_1198112223300031918FenMKKRECIRYALFVLAMVLACCCAPARGEDDRCGAGKDLVVRALERVTPQSDNGAFEDALQLLKHAVQECSELGDAWYYRSLVEKRLGHDAQAKYAMDKARFNGSEAMQQGLNPLMLATPTGRGFAAE
Ga0335079_1121608313300032783SoilMRTFAIPALAGVLISFGCSHAAGQEAHCGAGKDLVVQALERISPQSSQDAFEGALQLLKHAVSECEELGDAWYFRSLLEQKLGHDSLARYALDKARFLGSEAMQEGRNPLILSTPASRGISIEA
Ga0326728_1067455723300033402Peat SoilMKCAAISTLLGAFFFLSGLPVAGQETRCGAGKDLIVQALERISPQSDRNAFEDALQLLKHAVSECGELGDAWYYRSLVEQKLGHDQLAHYAMGKATFLGSEAMRQGLNPLVLATPSSRGIAVEAKPERPAQPN
Ga0326727_1005309513300033405Peat SoilMKICRRTRLASLALLAASAGLCVPAWGQGVRCGAGKDLVVQALERITPQSDNGAFEDALQLLKHAVQECSELGDAWYYRGLVEQRLGHDALAKYAMDKARFNDSEA
Ga0326727_1063887223300033405Peat SoilMISPTRSRLALLPLLAATMIACPGARAQGVRCGAGQDLIVQALERITPQSGNDAFEDALQLLKSAVAECPELGDAWYYRSLVEKRLGHDALANYAMDKARFNSSEALD
Ga0326727_1072623613300033405Peat SoilMSGHRRTRVASWMLFAAMTWVGSPAWGQAERCGAGMDLVVQALERVTPQSESSAFEDALQLLKHAVSECGELGDAWYYRSLVEQKLGHDALAKYALDKARLTGSEALQQ
Ga0326727_1098821423300033405Peat SoilMTLRIRPVAVILALLAATLFAHPRAAAQGIRCGAGQDLVVQALERITPQSGNDAFQDALELLKHAVSECPELGDAWYYRSLVEKRLGHDALASYAMDKARFNGSEALD
Ga0326727_1105537613300033405Peat SoilMSDWLRIGCLSVALLAASAGCSAPTWAQGERCGAGKDLVVQALERIAPQSDSGAFEDALQLLKHAISECGELGDAWYYRSLVEQRLGHDALAKYALDKA
Ga0371489_0160782_2_2773300033755Peat SoilMNNWLRSGCASLALTAAAAGVCSPAWAQGERCGAGKDLVVQALERITPQSDNGAFEDALQLLKHALSECGELGDAWYYRSLVEQRLGHDALA
Ga0371489_0276133_548_8233300033755Peat SoilMSRLHRSSILFLALLTATLVPCPRASAQDARCGAGQDLVVQALERITPQSGNDAFEDALELLKHAVSECPELGDAWYYRSLVEKRLGHDNLA
Ga0314861_0236203_3_3503300033977PeatlandMSRLKRSCILFLALLTAALVACPRTSAQSVRCGAGQDLVVQALERITPQSGNDAFEDALQLLKHAVSVCPELGDAWYYRSLVEKRLGHDALAQYALGKARFNGSEALDQDLNPLQL
Ga0334827_118410_497_8533300034065SoilMRRVRLAFLAALAVCLCSTAWGQGERCGAGKDLVVQALERISPEADRSAFEDALQLLKHAVSECSELGDAWYYRSLVEQRLGHDALAKYAMDKARFTNSEALQQGLNPLVLATPAGRGF
Ga0370494_081005_505_8193300034130Untreated Peat SoilMRIAACALLAAFCAQARAADDRCGAGKDLVVRALERISPTSDRGAFEDALQLLKHAVEECSELGDAWYYRSLVEQKLGHDALAKYAMDKARFNTSDALEQGLNPL


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.