 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F103088 |
| Family Type | Metagenome / Metatranscriptome |
| Number of Sequences | 101 |
| Average Sequence Length | 41 residues |
| Representative Sequence | LADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS |
| Number of Associated Samples | 70 |
| Number of Associated Scaffolds | 101 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | Yes |
| Most common taxonomic group | Bacteria |
| % of genes with valid RBS motifs | 0.99 % |
| % of genes near scaffold ends (potentially truncated) | 99.01 % |
| % of genes from short scaffolds (< 2000 bps) | 98.02 % |
| Associated GOLD sequencing projects | 62 |
| AlphaFold2 3D model prediction | No |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Bacteria (68.317 % of family members) |
| NCBI Taxonomy ID | 2 |
| Taxonomy | All Organisms → cellular organisms → Bacteria |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine (37.624 % of family members) |
| Environment Ontology (ENVO) | Unclassified (87.129 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (91.089 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 80.95% β-sheet: 0.00% Coil/Unstructured: 19.05% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 101 Family Scaffolds |
|---|---|---|
| PF00106 | adh_short | 0.99 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| All Organisms | root | All Organisms | 73.27 % |
| Unclassified | root | N/A | 26.73 % |
| Visualization |
|---|
| Powered by ApexCharts |
| Scaffold | Taxonomy | Length | IMG/M Link |
|---|---|---|---|
| 3300000973|BBAY93_10196416 | Not Available | 504 | Open in IMG/M |
| 3300001354|JGI20155J14468_10042065 | All Organisms → Viruses → Predicted Viral | 2034 | Open in IMG/M |
| 3300002488|JGI25128J35275_1032987 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1196 | Open in IMG/M |
| 3300002488|JGI25128J35275_1037726 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1093 | Open in IMG/M |
| 3300002488|JGI25128J35275_1046253 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 958 | Open in IMG/M |
| 3300005430|Ga0066849_10287149 | All Organisms → cellular organisms → Bacteria | 630 | Open in IMG/M |
| 3300006735|Ga0098038_1087668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1084 | Open in IMG/M |
| 3300006735|Ga0098038_1093650 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1042 | Open in IMG/M |
| 3300006735|Ga0098038_1149006 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 780 | Open in IMG/M |
| 3300006735|Ga0098038_1153895 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 764 | Open in IMG/M |
| 3300006737|Ga0098037_1032960 | All Organisms → Viruses → Predicted Viral | 1905 | Open in IMG/M |
| 3300006737|Ga0098037_1297992 | Not Available | 509 | Open in IMG/M |
| 3300006737|Ga0098037_1301448 | Not Available | 506 | Open in IMG/M |
| 3300006749|Ga0098042_1120921 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 654 | Open in IMG/M |
| 3300006749|Ga0098042_1183676 | Not Available | 504 | Open in IMG/M |
| 3300006802|Ga0070749_10375520 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 787 | Open in IMG/M |
| 3300006802|Ga0070749_10665208 | Not Available | 558 | Open in IMG/M |
| 3300006916|Ga0070750_10417410 | Not Available | 558 | Open in IMG/M |
| 3300006928|Ga0098041_1171580 | Not Available | 696 | Open in IMG/M |
| 3300006928|Ga0098041_1259071 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 554 | Open in IMG/M |
| 3300006929|Ga0098036_1044669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1382 | Open in IMG/M |
| 3300006929|Ga0098036_1143553 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 730 | Open in IMG/M |
| 3300006929|Ga0098036_1278073 | Not Available | 505 | Open in IMG/M |
| 3300007346|Ga0070753_1310064 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300007963|Ga0110931_1243556 | Not Available | 535 | Open in IMG/M |
| 3300008012|Ga0075480_10327387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 771 | Open in IMG/M |
| 3300008218|Ga0114904_1055352 | All Organisms → cellular organisms → Bacteria | 1027 | Open in IMG/M |
| 3300009481|Ga0114932_10187911 | Not Available | 1260 | Open in IMG/M |
| 3300009602|Ga0114900_1125787 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
| 3300009604|Ga0114901_1090041 | Not Available | 982 | Open in IMG/M |
| 3300009604|Ga0114901_1161513 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 667 | Open in IMG/M |
| 3300009703|Ga0114933_10252701 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1179 | Open in IMG/M |
| 3300009703|Ga0114933_10429635 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 863 | Open in IMG/M |
| 3300010148|Ga0098043_1136379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 700 | Open in IMG/M |
| 3300010148|Ga0098043_1157664 | Not Available | 640 | Open in IMG/M |
| 3300010148|Ga0098043_1173021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 605 | Open in IMG/M |
| 3300011013|Ga0114934_10517835 | Not Available | 527 | Open in IMG/M |
| 3300011253|Ga0151671_1018847 | Not Available | 527 | Open in IMG/M |
| 3300012919|Ga0160422_10409676 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 845 | Open in IMG/M |
| 3300012920|Ga0160423_10318746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1068 | Open in IMG/M |
| 3300012920|Ga0160423_10583091 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 758 | Open in IMG/M |
| 3300012936|Ga0163109_10144951 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1743 | Open in IMG/M |
| 3300016733|Ga0182042_1159629 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 755 | Open in IMG/M |
| 3300017708|Ga0181369_1086260 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 663 | Open in IMG/M |
| 3300017708|Ga0181369_1115652 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 548 | Open in IMG/M |
| 3300017717|Ga0181404_1103072 | Not Available | 699 | Open in IMG/M |
| 3300017719|Ga0181390_1173082 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 531 | Open in IMG/M |
| 3300017728|Ga0181419_1069874 | Not Available | 889 | Open in IMG/M |
| 3300017740|Ga0181418_1105659 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 682 | Open in IMG/M |
| 3300017748|Ga0181393_1137085 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 614 | Open in IMG/M |
| 3300017755|Ga0181411_1160677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 644 | Open in IMG/M |
| 3300017759|Ga0181414_1045075 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1184 | Open in IMG/M |
| 3300017759|Ga0181414_1048383 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1139 | Open in IMG/M |
| 3300017764|Ga0181385_1076381 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1032 | Open in IMG/M |
| 3300017764|Ga0181385_1185022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 629 | Open in IMG/M |
| 3300017772|Ga0181430_1181876 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 604 | Open in IMG/M |
| 3300020207|Ga0181570_10074793 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1959 | Open in IMG/M |
| 3300020378|Ga0211527_10234346 | Not Available | 504 | Open in IMG/M |
| 3300020392|Ga0211666_10370169 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 527 | Open in IMG/M |
| 3300020397|Ga0211583_10157638 | Not Available | 837 | Open in IMG/M |
| 3300020403|Ga0211532_10167206 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 893 | Open in IMG/M |
| 3300020420|Ga0211580_10335208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 620 | Open in IMG/M |
| 3300020436|Ga0211708_10083462 | All Organisms → Viruses → Predicted Viral | 1243 | Open in IMG/M |
| 3300020436|Ga0211708_10367342 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 589 | Open in IMG/M |
| 3300020440|Ga0211518_10149760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1183 | Open in IMG/M |
| 3300020451|Ga0211473_10253542 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 905 | Open in IMG/M |
| 3300022074|Ga0224906_1066403 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1119 | Open in IMG/M |
| 3300022178|Ga0196887_1081438 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 756 | Open in IMG/M |
| 3300022939|Ga0255754_10187074 | Not Available | 1053 | Open in IMG/M |
| 3300024344|Ga0209992_10128669 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1116 | Open in IMG/M |
| 3300024344|Ga0209992_10225970 | Not Available | 786 | Open in IMG/M |
| 3300025086|Ga0208157_1082960 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 797 | Open in IMG/M |
| 3300025101|Ga0208159_1047582 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 900 | Open in IMG/M |
| 3300025120|Ga0209535_1155581 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300025127|Ga0209348_1083595 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1015 | Open in IMG/M |
| 3300025127|Ga0209348_1152759 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 677 | Open in IMG/M |
| 3300025128|Ga0208919_1110299 | Not Available | 880 | Open in IMG/M |
| 3300025132|Ga0209232_1130378 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 821 | Open in IMG/M |
| 3300025137|Ga0209336_10124249 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 704 | Open in IMG/M |
| 3300025151|Ga0209645_1112846 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 870 | Open in IMG/M |
| 3300025151|Ga0209645_1136734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 765 | Open in IMG/M |
| 3300025151|Ga0209645_1153100 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 709 | Open in IMG/M |
| 3300025151|Ga0209645_1198945 | Not Available | 592 | Open in IMG/M |
| 3300025151|Ga0209645_1209918 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 568 | Open in IMG/M |
| 3300025277|Ga0208180_1096066 | Not Available | 666 | Open in IMG/M |
| 3300025277|Ga0208180_1117912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 569 | Open in IMG/M |
| 3300025282|Ga0208030_1075298 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 897 | Open in IMG/M |
| 3300025806|Ga0208545_1098686 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 767 | Open in IMG/M |
| 3300025853|Ga0208645_1271909 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 550 | Open in IMG/M |
| 3300025889|Ga0208644_1340752 | Not Available | 576 | Open in IMG/M |
| 3300026202|Ga0207984_1135572 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 562 | Open in IMG/M |
| 3300028022|Ga0256382_1151975 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 555 | Open in IMG/M |
| 3300029309|Ga0183683_1004701 | All Organisms → Viruses → Predicted Viral | 4352 | Open in IMG/M |
| 3300029318|Ga0185543_1068306 | Not Available | 726 | Open in IMG/M |
| 3300029318|Ga0185543_1085911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 622 | Open in IMG/M |
| 3300029318|Ga0185543_1101644 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 553 | Open in IMG/M |
| 3300029318|Ga0185543_1112302 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Pacearchaeota → Candidatus Pacearchaeota archaeon | 515 | Open in IMG/M |
| 3300029787|Ga0183757_1069212 | Not Available | 529 | Open in IMG/M |
| 3300029792|Ga0183826_1028359 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 888 | Open in IMG/M |
| 3300032006|Ga0310344_10972349 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 713 | Open in IMG/M |
| 3300034655|Ga0326746_034243 | Not Available | 541 | Open in IMG/M |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 37.62% |
| Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 15.84% |
| Seawater | Environmental → Aquatic → Marine → Strait → Unclassified → Seawater | 11.88% |
| Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 8.91% |
| Deep Ocean | Environmental → Aquatic → Marine → Oceanic → Unclassified → Deep Ocean | 6.93% |
| Deep Subsurface | Environmental → Aquatic → Marine → Volcanic → Unclassified → Deep Subsurface | 5.94% |
| Surface Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater | 2.97% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.97% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Unclassified → Seawater | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Oceanic → Photic Zone → Seawater | 0.99% |
| Marine | Environmental → Aquatic → Marine → Coastal → Unclassified → Marine | 0.99% |
| Filtered Seawater | Environmental → Aquatic → Marine → Unclassified → Unclassified → Filtered Seawater | 0.99% |
| Seawater | Environmental → Aquatic → Marine → Pelagic → Unclassified → Seawater | 0.99% |
| Pelagic Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Pelagic Marine | 0.99% |
| Macroalgal Surface | Host-Associated → Algae → Green Algae → Ectosymbionts → Unclassified → Macroalgal Surface | 0.99% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300000973 | Macroalgal surface ecosystem from Botany Bay, Sydney, Australia - BBAY93 | Host-Associated | Open in IMG/M |
| 3300001354 | Pelagic Microbial community sample from North Sea - COGITO 998_met_05 | Environmental | Open in IMG/M |
| 3300002488 | Marine viral communities from the Pacific Ocean - ETNP_2_60 | Environmental | Open in IMG/M |
| 3300005430 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV69 | Environmental | Open in IMG/M |
| 3300006735 | Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaG | Environmental | Open in IMG/M |
| 3300006737 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG | Environmental | Open in IMG/M |
| 3300006749 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG | Environmental | Open in IMG/M |
| 3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
| 3300006916 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 | Environmental | Open in IMG/M |
| 3300006928 | Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaG | Environmental | Open in IMG/M |
| 3300006929 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG | Environmental | Open in IMG/M |
| 3300007346 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31 | Environmental | Open in IMG/M |
| 3300007963 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2) | Environmental | Open in IMG/M |
| 3300008012 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_<0.8_DNA | Environmental | Open in IMG/M |
| 3300008218 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s6 | Environmental | Open in IMG/M |
| 3300009481 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG | Environmental | Open in IMG/M |
| 3300009602 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_231 | Environmental | Open in IMG/M |
| 3300009604 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 | Environmental | Open in IMG/M |
| 3300009703 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV12_W25 metaG | Environmental | Open in IMG/M |
| 3300010148 | Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaG | Environmental | Open in IMG/M |
| 3300011013 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 4SBTROV10_white metaG | Environmental | Open in IMG/M |
| 3300011253 | Seawater microbial communities from Japan Sea near Toyama Prefecture, Japan - 2014_2, permeate | Environmental | Open in IMG/M |
| 3300012919 | Marine microbial communities from the Central Pacific Ocean - Fk160115 60m metaG | Environmental | Open in IMG/M |
| 3300012920 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaG | Environmental | Open in IMG/M |
| 3300012936 | Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St13 metaG | Environmental | Open in IMG/M |
| 3300016733 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011501AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
| 3300017708 | Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaG | Environmental | Open in IMG/M |
| 3300017717 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 27 SPOT_SRF_2011-10-25 | Environmental | Open in IMG/M |
| 3300017719 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 | Environmental | Open in IMG/M |
| 3300017728 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24 | Environmental | Open in IMG/M |
| 3300017740 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13 | Environmental | Open in IMG/M |
| 3300017748 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 16 SPOT_SRF_2010-10-21 | Environmental | Open in IMG/M |
| 3300017755 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 34 SPOT_SRF_2012-07-09 | Environmental | Open in IMG/M |
| 3300017759 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 37 SPOT_SRF_2012-11-28 | Environmental | Open in IMG/M |
| 3300017764 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11 | Environmental | Open in IMG/M |
| 3300017772 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 53 SPOT_SRF_2014-04-10 | Environmental | Open in IMG/M |
| 3300020207 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101406AT metaG (spades assembly) | Environmental | Open in IMG/M |
| 3300020378 | Marine microbial communities from Tara Oceans - TARA_B100000066 (ERX556006-ERR599102) | Environmental | Open in IMG/M |
| 3300020392 | Marine microbial communities from Tara Oceans - TARA_B100000963 (ERX555916-ERR599163) | Environmental | Open in IMG/M |
| 3300020397 | Marine microbial communities from Tara Oceans - TARA_B100000123 (ERX556052-ERR599075) | Environmental | Open in IMG/M |
| 3300020403 | Marine microbial communities from Tara Oceans - TARA_B100000085 (ERX556015-ERR599145) | Environmental | Open in IMG/M |
| 3300020420 | Marine microbial communities from Tara Oceans - TARA_B100001248 (ERX556094-ERR599142) | Environmental | Open in IMG/M |
| 3300020436 | Marine microbial communities from Tara Oceans - TARA_B100000424 (ERX556009-ERR598984) | Environmental | Open in IMG/M |
| 3300020440 | Marine microbial communities from Tara Oceans - TARA_E500000178 (ERX555952-ERR599043) | Environmental | Open in IMG/M |
| 3300020451 | Marine microbial communities from Tara Oceans - TARA_B100001778 (ERX555927-ERR598996) | Environmental | Open in IMG/M |
| 3300022074 | Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10 (v2) | Environmental | Open in IMG/M |
| 3300022178 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (v3) | Environmental | Open in IMG/M |
| 3300022939 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG | Environmental | Open in IMG/M |
| 3300024344 | Deep subsurface microbial communities from Kolumbo volcano to uncover new lineages of life (NeLLi) - 2SBTROV12_ACTIVE470 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025086 | Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025101 | Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025120 | Marine viral communities from the Pacific Ocean - LP-28 (SPAdes) | Environmental | Open in IMG/M |
| 3300025127 | Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025128 | Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025132 | Marine viral communities from the Pacific Ocean - ETNP_2_60 (SPAdes) | Environmental | Open in IMG/M |
| 3300025137 | Marine viral communities from the Pacific Ocean - LP-32 (SPAdes) | Environmental | Open in IMG/M |
| 3300025151 | Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes) | Environmental | Open in IMG/M |
| 3300025277 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_s16 (SPAdes) | Environmental | Open in IMG/M |
| 3300025282 | Marine viral communities from the Global Malaspina Expedition - Malaspina viral metaG DeepMed_M9 (SPAdes) | Environmental | Open in IMG/M |
| 3300025806 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_30_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
| 3300025853 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (SPAdes) | Environmental | Open in IMG/M |
| 3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
| 3300026202 | Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF43B (SPAdes) | Environmental | Open in IMG/M |
| 3300028022 | Seawater viral communities from deep brine pools at the bottom of the Mediterranean Sea - LS1 750m | Environmental | Open in IMG/M |
| 3300029309 | Marine viral communities collected during Tara Oceans survey from station TARA_100 - TARA_R100001440 | Environmental | Open in IMG/M |
| 3300029318 | Marine giant viral communities collected during Tara Oceans survey from station TARA_038 - TARA_Y100000289 | Environmental | Open in IMG/M |
| 3300029787 | Marine viral communities collected during Tara Oceans survey from station TARA_018 - TARA_A100000172 | Environmental | Open in IMG/M |
| 3300029792 | Marine giant viral communities collected during Tara Oceans survey from station TARA_041 - TARA_Y100000052 | Environmental | Open in IMG/M |
| 3300032006 | Marine microbial communities from station ALOHA, North Pacific Subtropical Gyre - HC15-DNA-20-200_MG | Environmental | Open in IMG/M |
| 3300034655 | Seawater viral communities from Mid-Atlantic Ridge, Atlantic Ocean - 494_2800 | Environmental | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| BBAY93_101964163 | 3300000973 | Macroalgal Surface | RDFQRKLRLLKVDYATRNDYMRSDTIAESIAVNIGGRVS* |
| JGI20155J14468_100420654 | 3300001354 | Pelagic Marine | MQLADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATSIGGRVS* |
| JGI25128J35275_10329871 | 3300002488 | Marine | ADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS* |
| JGI25128J35275_10377263 | 3300002488 | Marine | AQLADRDFQRKLKLLKVDYATKNDYMRSDSIAESIAVNIGGRVS* |
| JGI25128J35275_10462531 | 3300002488 | Marine | RDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA* |
| Ga0066849_102871491 | 3300005430 | Marine | DYQRKLKLLKTDYGTHADYMRTDVIGESIATNIGGRVIA* |
| Ga0098038_10876681 | 3300006735 | Marine | QRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0098038_10936501 | 3300006735 | Marine | PQHAQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESITTSIGGRAS* |
| Ga0098038_11490061 | 3300006735 | Marine | ADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA* |
| Ga0098038_11538951 | 3300006735 | Marine | KLRLLKVDYATKNDYMRTDTIAESISLNIGGRVN* |
| Ga0098037_10329601 | 3300006737 | Marine | DRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA* |
| Ga0098037_12979921 | 3300006737 | Marine | DFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0098037_13014481 | 3300006737 | Marine | SDPQHAQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESIATNIGGRIS* |
| Ga0098042_11209211 | 3300006749 | Marine | RKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0098042_11836761 | 3300006749 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNMGGRVS* |
| Ga0070749_103755203 | 3300006802 | Aqueous | PQHAQLADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0070749_106652081 | 3300006802 | Aqueous | ADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0070750_104174103 | 3300006916 | Aqueous | KLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0098041_11715801 | 3300006928 | Marine | QRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS* |
| Ga0098041_12590711 | 3300006928 | Marine | RKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA* |
| Ga0098036_10446694 | 3300006929 | Marine | QHAQLADRDFQRKLRLLKVDYATKNDYMRSDVIGESIATNIGGRVS* |
| Ga0098036_11435533 | 3300006929 | Marine | FQRKLRLLKVDYATKNDYMRSDTIGESITTSIGGRAS* |
| Ga0098036_12780731 | 3300006929 | Marine | RKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS* |
| Ga0070753_13100641 | 3300007346 | Aqueous | AQLADRDFQRKLRLLKVDYATKNDYMRTDTIAESISLNIGGRVN* |
| Ga0110931_12435563 | 3300007963 | Marine | LADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATQIGGRVS* |
| Ga0075480_103273871 | 3300008012 | Aqueous | QRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA* |
| Ga0114904_10553521 | 3300008218 | Deep Ocean | PQHAQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS* |
| Ga0114932_101879111 | 3300009481 | Deep Subsurface | QLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS* |
| Ga0114900_11257871 | 3300009602 | Deep Ocean | LADRDYQRKLKLLKTDYGTHADYMRTDVIGESIATNIGGRVIA* |
| Ga0114901_10900411 | 3300009604 | Deep Ocean | HAQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS* |
| Ga0114901_11615133 | 3300009604 | Deep Ocean | PQHAQLADRDFQRKLRLLKVDYATKNDYMRSDVIGESIATNIGGRVS* |
| Ga0114933_102527013 | 3300009703 | Deep Subsurface | AQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS* |
| Ga0114933_104296351 | 3300009703 | Deep Subsurface | RKLRLLKVDYATKNDYMRSDTIGESIATNIGGRVS* |
| Ga0098043_11363793 | 3300010148 | Marine | AQLADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS* |
| Ga0098043_11576641 | 3300010148 | Marine | AQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESITTSIGGRAS* |
| Ga0098043_11730213 | 3300010148 | Marine | LADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS* |
| Ga0114934_105178353 | 3300011013 | Deep Subsurface | LADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS* |
| Ga0151671_10188473 | 3300011253 | Marine | QLVDRDFQRKLRLLKVDYATKNDYMRSDTIAESIATHIGGRVG* |
| Ga0160422_104096763 | 3300012919 | Seawater | FQRKLRLLKVDYATKNDYMRSDTIAESIATNIGARAS* |
| Ga0160423_103187461 | 3300012920 | Surface Seawater | AQLADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA* |
| Ga0160423_105830913 | 3300012920 | Surface Seawater | AQLADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS* |
| Ga0163109_101449511 | 3300012936 | Surface Seawater | HAQLADRDFQRKLRLLKVDYATKNDYMRSDTLTESIATNIGGRVS* |
| Ga0182042_11596293 | 3300016733 | Salt Marsh | QHAQLADRDFQRKLRLLKVDYATKNDYMRTDTIAESISLNIGGRVN |
| Ga0181369_10862601 | 3300017708 | Marine | DFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA |
| Ga0181369_11156523 | 3300017708 | Marine | AQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESITTSIGGRAS |
| Ga0181404_11030721 | 3300017717 | Seawater | GGDFQRKLRLLKVDYATKNDYMRTDVIGESIATSIGGRVS |
| Ga0181390_11730823 | 3300017719 | Seawater | DRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA |
| Ga0181419_10698741 | 3300017728 | Seawater | RRRFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0181418_11056591 | 3300017740 | Seawater | KGMRNDRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0181393_11370853 | 3300017748 | Seawater | PQHAQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0181411_11606771 | 3300017755 | Seawater | ADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0181414_10450751 | 3300017759 | Seawater | QRKLRLLKVDYATRNDYMRSDAIGESIATNIGGRAS |
| Ga0181414_10483833 | 3300017759 | Seawater | FQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0181385_10763814 | 3300017764 | Seawater | LADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATSIGGRVS |
| Ga0181385_11850221 | 3300017764 | Seawater | QRKLRLLKVDYATKNDYMRSDTIAESIATSIGGRVS |
| Ga0181430_11818763 | 3300017772 | Seawater | AQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESIATNIGGRVS |
| Ga0181570_100747933 | 3300020207 | Salt Marsh | FQRKLRLLKVDYATKNDYMRTDTIAESISLNIGGRVN |
| Ga0211527_102343463 | 3300020378 | Marine | LADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA |
| Ga0211666_103701691 | 3300020392 | Marine | RKLRLLKVDYATKNDYMRSDSIGESIATNMGGRVS |
| Ga0211583_101576383 | 3300020397 | Marine | LADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGARAN |
| Ga0211532_101672061 | 3300020403 | Marine | DPQHAQLADRDFQRKLRLLKVDYATKNDYMRSDSIAESIATNIGGRVS |
| Ga0211580_103352083 | 3300020420 | Marine | DRDFQRKLRLLKVDYATKNDYMRSDSIAESITTSIGGRSI |
| Ga0211708_100834621 | 3300020436 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRSDAIAESITTQIGGRIS |
| Ga0211708_103673423 | 3300020436 | Marine | DRDFQRKLRLLKVDYATKNDYMRSDTIAESIATQIGGRVS |
| Ga0211518_101497601 | 3300020440 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0211473_102535423 | 3300020451 | Marine | RKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS |
| Ga0224906_10664031 | 3300022074 | Seawater | LADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0196887_10814383 | 3300022178 | Aqueous | PQHAQLADRDFQRKLRLLKVDYATKNDYMRTDTIAESISLNIGGRVN |
| Ga0255754_101870741 | 3300022939 | Salt Marsh | AQLADRDFQRKLRLLKVDYATKNDYMRTDTIAESISLNIGGRVS |
| Ga0209992_101286692 | 3300024344 | Deep Subsurface | RDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVN |
| Ga0209992_102259701 | 3300024344 | Deep Subsurface | AQLADRDFQRKLRLLKVDYATKNDYMRTDTIGESIATNIGGRVS |
| Ga0208157_10829603 | 3300025086 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS |
| Ga0208159_10475823 | 3300025101 | Marine | RDFQRKLRLLKVDYATKNDYMRSDTIGESITTSIGGRAS |
| Ga0209535_11555813 | 3300025120 | Marine | FQRKLRLLKVDYATKNDYMRTDVIGESIATSIGGRVS |
| Ga0209348_10835953 | 3300025127 | Marine | FQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS |
| Ga0209348_11527593 | 3300025127 | Marine | QRKLRLLKVDYATKNDYMRSDVIGESIATNIGGRVS |
| Ga0208919_11102991 | 3300025128 | Marine | QRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVS |
| Ga0209232_11303783 | 3300025132 | Marine | RDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA |
| Ga0209336_101242493 | 3300025137 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATSIGGRVS |
| Ga0209645_11128461 | 3300025151 | Marine | FQRKLRLLKVDYATKNDYMRTDTIAESITTQIGGRIS |
| Ga0209645_11367341 | 3300025151 | Marine | DPQHAQLADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGARAN |
| Ga0209645_11531003 | 3300025151 | Marine | ADRDFQRKLRLLKVDYATKNDYMRSDAIAESITTQIGGRIS |
| Ga0209645_11989453 | 3300025151 | Marine | LADRDYQRKLRLLKVDYATKNDYMRSDTISESIATNIGGRTN |
| Ga0209645_12099183 | 3300025151 | Marine | QLADRDFQRKLRLLKVDYATKNDYMRSDTIAESITTQIGGRVS |
| Ga0208180_10960662 | 3300025277 | Deep Ocean | LADRDFQRKLKLLKTDYGTHADYMRSDTIAESIATSIGRVSS |
| Ga0208180_11179122 | 3300025277 | Deep Ocean | QHAQLADRDYQRKLKLLKTDYGTHADYMRSDTIGESIATNIGVAS |
| Ga0208030_10752983 | 3300025282 | Deep Ocean | LADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATSIGGRVS |
| Ga0208545_10986861 | 3300025806 | Aqueous | LADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS |
| Ga0208645_12719091 | 3300025853 | Aqueous | DRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS |
| Ga0208644_13407521 | 3300025889 | Aqueous | PQHAQLADRDFQRKLRLLKVDYATKNDYMRTDVIGESIATNIGGRVS |
| Ga0207984_11355723 | 3300026202 | Marine | QLADRDYQRKLKLLKTDYGTHADYMRTDVIGESIATNIGGRVIA |
| Ga0256382_11519751 | 3300028022 | Seawater | DFQRKLRLLKVDYATKNDYMRSDVIGESIATNIGGRVS |
| Ga0183683_10047011 | 3300029309 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESITTSIGGRAS |
| Ga0185543_10683063 | 3300029318 | Marine | QLADRDFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA |
| Ga0185543_10859111 | 3300029318 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRSDTIGESIATNIGGRVS |
| Ga0185543_11016443 | 3300029318 | Marine | RKLRLLKVDYATKNDYMRSDTIAESIATNIGGRVA |
| Ga0185543_11123022 | 3300029318 | Marine | HAQLADRDFQRKLRLLKVDYATKNDYMRSDAISESISTNIGGRVT |
| Ga0183757_10692123 | 3300029787 | Marine | QHAQLADRDFQRKLRLLKVDYATKNDYMRSDVIGESIATNIGGRVS |
| Ga0183826_10283593 | 3300029792 | Marine | DFQRKLRLLKVDYATKNDYMRSDTIAESIATNIGARAS |
| Ga0310344_109723491 | 3300032006 | Seawater | AQLADRDFQRKLRLLKVDYATKNDYMRSDVIGESIATNIGGRVS |
| Ga0326746_034243_1_141 | 3300034655 | Filtered Seawater | GRDAQLADRDYQRKLKLLKTDYGTHADYMRSDTIAESIATNVGVAS |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |