NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F103092

Metagenome Family F103092

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103092
Family Type Metagenome
Number of Sequences 101
Average Sequence Length 58 residues
Representative Sequence MANLNNQGKRPDQYENSAKFAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Number of Associated Samples 68
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 5.94 %
% of genes near scaffold ends (potentially truncated) 16.83 %
% of genes from short scaffolds (< 2000 bps) 86.14 %
Associated GOLD sequencing projects 62
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (75.248 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(28.713 % of family members)
Environment Ontology (ENVO) Unclassified
(88.119 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(100.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 51.72%    β-sheet: 0.00%    Coil/Unstructured: 48.28%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF10544T5orf172 17.82
PF00583Acetyltransf_1 3.96
PF13673Acetyltransf_10 0.99


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms86.14 %
UnclassifiedrootN/A13.86 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002482|JGI25127J35165_1007059All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium2919Open in IMG/M
3300002482|JGI25127J35165_1081066All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium668Open in IMG/M
3300002482|JGI25127J35165_1117866Not Available526Open in IMG/M
3300004829|Ga0068515_114540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium985Open in IMG/M
3300006025|Ga0075474_10029560All Organisms → cellular organisms → Bacteria1936Open in IMG/M
3300006026|Ga0075478_10072550All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1112Open in IMG/M
3300006735|Ga0098038_1043404All Organisms → Viruses → Predicted Viral1642Open in IMG/M
3300006749|Ga0098042_1126873All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium634Open in IMG/M
3300006749|Ga0098042_1151946All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300006752|Ga0098048_1028566All Organisms → Viruses → Predicted Viral1826Open in IMG/M
3300006752|Ga0098048_1060603All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1176Open in IMG/M
3300006867|Ga0075476_10068601All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1402Open in IMG/M
3300006919|Ga0070746_10141275Not Available1177Open in IMG/M
3300007234|Ga0075460_10133663All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium872Open in IMG/M
3300007236|Ga0075463_10067903All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1151Open in IMG/M
3300007542|Ga0099846_1009609All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3842Open in IMG/M
3300010148|Ga0098043_1082529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium952Open in IMG/M
3300010148|Ga0098043_1092426All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium889Open in IMG/M
3300010148|Ga0098043_1149072All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium663Open in IMG/M
3300010148|Ga0098043_1191332All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium568Open in IMG/M
3300010296|Ga0129348_1255989All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium588Open in IMG/M
3300010300|Ga0129351_1035496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2057Open in IMG/M
3300010300|Ga0129351_1336921All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium567Open in IMG/M
3300012920|Ga0160423_10378375All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium969Open in IMG/M
3300012920|Ga0160423_10640905All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium719Open in IMG/M
3300012920|Ga0160423_10660594Not Available706Open in IMG/M
3300012920|Ga0160423_10989555All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium563Open in IMG/M
3300012954|Ga0163111_12301491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium546Open in IMG/M
3300012954|Ga0163111_12602892All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium516Open in IMG/M
3300017706|Ga0181377_1001960All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium6477Open in IMG/M
3300017706|Ga0181377_1023604All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1327Open in IMG/M
3300017706|Ga0181377_1027887Not Available1187Open in IMG/M
3300017706|Ga0181377_1052172All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium780Open in IMG/M
3300017708|Ga0181369_1046201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium985Open in IMG/M
3300017708|Ga0181369_1046859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium976Open in IMG/M
3300017708|Ga0181369_1092151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium635Open in IMG/M
3300017709|Ga0181387_1003127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium3328Open in IMG/M
3300017709|Ga0181387_1050256All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium830Open in IMG/M
3300017709|Ga0181387_1077107Not Available673Open in IMG/M
3300017709|Ga0181387_1099156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium596Open in IMG/M
3300017710|Ga0181403_1003497All Organisms → Viruses → Predicted Viral3500Open in IMG/M
3300017713|Ga0181391_1031670All Organisms → cellular organisms → Bacteria1287Open in IMG/M
3300017720|Ga0181383_1020010All Organisms → Viruses → Predicted Viral1797Open in IMG/M
3300017726|Ga0181381_1087168All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium666Open in IMG/M
3300017727|Ga0181401_1064742Not Available975Open in IMG/M
3300017728|Ga0181419_1005838All Organisms → Viruses → Predicted Viral3807Open in IMG/M
3300017728|Ga0181419_1067067All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium912Open in IMG/M
3300017730|Ga0181417_1019047All Organisms → cellular organisms → Bacteria1727Open in IMG/M
3300017731|Ga0181416_1036859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1149Open in IMG/M
3300017738|Ga0181428_1043580All Organisms → Viruses → Predicted Viral1044Open in IMG/M
3300017739|Ga0181433_1069086All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium881Open in IMG/M
3300017739|Ga0181433_1127170All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium607Open in IMG/M
3300017740|Ga0181418_1163761All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300017751|Ga0187219_1174568All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium606Open in IMG/M
3300017760|Ga0181408_1037814Not Available1311Open in IMG/M
3300017760|Ga0181408_1125619All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium664Open in IMG/M
3300017762|Ga0181422_1143135All Organisms → cellular organisms → Bacteria735Open in IMG/M
3300017763|Ga0181410_1186347All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium573Open in IMG/M
3300017764|Ga0181385_1043735All Organisms → Viruses → Predicted Viral1400Open in IMG/M
3300017765|Ga0181413_1043654All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1395Open in IMG/M
3300017768|Ga0187220_1018491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2098Open in IMG/M
3300017769|Ga0187221_1199876All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium577Open in IMG/M
3300017951|Ga0181577_10107127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1931Open in IMG/M
3300017951|Ga0181577_10670287All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium634Open in IMG/M
3300017956|Ga0181580_10952837All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium533Open in IMG/M
3300017967|Ga0181590_10447612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium909Open in IMG/M
3300017986|Ga0181569_10718046Not Available660Open in IMG/M
3300018428|Ga0181568_11123718All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium593Open in IMG/M
3300020176|Ga0181556_1109571All Organisms → Viruses → Predicted Viral1227Open in IMG/M
3300020176|Ga0181556_1142056All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1001Open in IMG/M
3300020379|Ga0211652_10100706Not Available872Open in IMG/M
3300020404|Ga0211659_10510771All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium512Open in IMG/M
3300020414|Ga0211523_10164726Not Available925Open in IMG/M
3300020437|Ga0211539_10459838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium530Open in IMG/M
3300020439|Ga0211558_10092999All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1477Open in IMG/M
3300020442|Ga0211559_10195794Not Available955Open in IMG/M
3300020470|Ga0211543_10179957All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1052Open in IMG/M
3300021347|Ga0213862_10225201All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium661Open in IMG/M
3300021425|Ga0213866_10367522Not Available708Open in IMG/M
3300022053|Ga0212030_1005234All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1454Open in IMG/M
3300025070|Ga0208667_1010213All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2171Open in IMG/M
3300025086|Ga0208157_1054713All Organisms → Viruses → Predicted Viral1060Open in IMG/M
3300025098|Ga0208434_1025036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1451Open in IMG/M
3300025127|Ga0209348_1006669All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium4861Open in IMG/M
3300025127|Ga0209348_1020472All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2481Open in IMG/M
3300025127|Ga0209348_1126696All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium769Open in IMG/M
3300025151|Ga0209645_1046978All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1528Open in IMG/M
3300025151|Ga0209645_1053459All Organisms → Viruses → Predicted Viral1409Open in IMG/M
3300025151|Ga0209645_1137913All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium761Open in IMG/M
3300025151|Ga0209645_1201875All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium585Open in IMG/M
3300025687|Ga0208019_1113911All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium810Open in IMG/M
3300025751|Ga0208150_1266328All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium514Open in IMG/M
3300025769|Ga0208767_1188612Not Available706Open in IMG/M
3300025818|Ga0208542_1138945All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium669Open in IMG/M
3300025828|Ga0208547_1209875Not Available520Open in IMG/M
3300029306|Ga0135212_1021530All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium659Open in IMG/M
3300029319|Ga0183748_1006221All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium5505Open in IMG/M
3300029319|Ga0183748_1018378All Organisms → Viruses → Predicted Viral2552Open in IMG/M
3300029319|Ga0183748_1023703All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium2115Open in IMG/M
3300029319|Ga0183748_1055383All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium1096Open in IMG/M
3300029345|Ga0135210_1022890All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → unclassified Bacteroidetes → Bacteroidetes bacterium649Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine28.71%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater25.74%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous12.87%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine10.89%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh7.92%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater5.94%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient2.97%
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater1.98%
Marine HarborEnvironmental → Aquatic → Marine → Harbor → Unclassified → Marine Harbor1.98%
Marine WaterEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine Water0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002482Marine viral communities from the Pacific Ocean - ETNP_2_30EnvironmentalOpen in IMG/M
3300004829Marine water microbial communities from the Pohang Bay, Korea with extracellular vesicles - Pohang-EVsEnvironmentalOpen in IMG/M
3300006025Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006026Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNAEnvironmentalOpen in IMG/M
3300006735Marine viral communities from the Subarctic Pacific Ocean - 5B_ETSP_OMZ_AT15132_CsCl metaGEnvironmentalOpen in IMG/M
3300006749Marine viral communities from the Subarctic Pacific Ocean - 9_ETSP_OMZ_AT15188 metaGEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007236Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_>0.8_DNAEnvironmentalOpen in IMG/M
3300007542Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaGEnvironmentalOpen in IMG/M
3300010148Marine viral communities from the Subarctic Pacific Ocean - 9B_ETSP_OMZ_AT15188_CsCl metaGEnvironmentalOpen in IMG/M
3300010296Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNAEnvironmentalOpen in IMG/M
3300010300Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNAEnvironmentalOpen in IMG/M
3300012920Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St8 metaGEnvironmentalOpen in IMG/M
3300012954Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St18 metaGEnvironmentalOpen in IMG/M
3300017706Marine viral communities from the Subarctic Pacific Ocean - Lowphox_13 viral metaGEnvironmentalOpen in IMG/M
3300017708Marine viral communities from the Subarctic Pacific Ocean - Lowphox_04 viral metaGEnvironmentalOpen in IMG/M
3300017709Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 10 SPOT_SRF_2010-04-27EnvironmentalOpen in IMG/M
3300017710Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 26 SPOT_SRF_2011-09-28EnvironmentalOpen in IMG/M
3300017713Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 14 SPOT_SRF_2010-08-11EnvironmentalOpen in IMG/M
3300017720Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23EnvironmentalOpen in IMG/M
3300017726Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 4 SPOT_SRF_2009-09-24EnvironmentalOpen in IMG/M
3300017727Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 24 SPOT_SRF_2011-07-20EnvironmentalOpen in IMG/M
3300017728Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 42 SPOT_SRF_2013-04-24EnvironmentalOpen in IMG/M
3300017730Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 40 SPOT_SRF_2013-02-13EnvironmentalOpen in IMG/M
3300017731Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 39 SPOT_SRF_2013-01-16EnvironmentalOpen in IMG/M
3300017738Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 51 SPOT_SRF_2014-02-12EnvironmentalOpen in IMG/M
3300017739Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 56 SPOT_SRF_2014-09-10EnvironmentalOpen in IMG/M
3300017740Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 41 SPOT_SRF_2013-03-13EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017762Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 45 SPOT_SRF_2013-07-18EnvironmentalOpen in IMG/M
3300017763Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 33 SPOT_SRF_2012-06-20EnvironmentalOpen in IMG/M
3300017764Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 8 SPOT_SRF_2010-02-11EnvironmentalOpen in IMG/M
3300017765Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 36 SPOT_SRF_2012-09-28EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017769Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 5 SPOT_SRF_2009-10-22 (version 2)EnvironmentalOpen in IMG/M
3300017951Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017956Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300017986Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101405AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020176Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011505AT metaG (spades assembly)EnvironmentalOpen in IMG/M
3300020379Marine microbial communities from Tara Oceans - TARA_B100000902 (ERX556001-ERR599168)EnvironmentalOpen in IMG/M
3300020404Marine microbial communities from Tara Oceans - TARA_B100000900 (ERX555954-ERR598978)EnvironmentalOpen in IMG/M
3300020414Marine microbial communities from Tara Oceans - TARA_B100000035 (ERX556019-ERR599028)EnvironmentalOpen in IMG/M
3300020437Marine microbial communities from Tara Oceans - TARA_B100000282 (ERX555906-ERR599074)EnvironmentalOpen in IMG/M
3300020439Marine microbial communities from Tara Oceans - TARA_B100001939 (ERX556062-ERR599029)EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020470Marine microbial communities from Tara Oceans - TARA_B100000287 (ERX555976-ERR599053)EnvironmentalOpen in IMG/M
3300021347Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO266EnvironmentalOpen in IMG/M
3300021425Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284EnvironmentalOpen in IMG/M
3300022053Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_2 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025127Marine viral communities from the Pacific Ocean - ETNP_2_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025687Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025769Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (SPAdes)EnvironmentalOpen in IMG/M
3300025818Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025828Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300029306Marine harbor viral communities from the Indian Ocean - SCH3EnvironmentalOpen in IMG/M
3300029319Marine viral communities collected during Tara Oceans survey from station TARA_032 - TARA_A100001516EnvironmentalOpen in IMG/M
3300029345Marine harbor viral communities from the Indian Ocean - SCH1EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25127J35165_100705943300002482MarineMANMNNQGKRSDQYSNSAKFAWYGVVGMITLLVLLTLLGGCSTTKKVDECCKSQKTSTK*
JGI25127J35165_108106623300002482MarineMANLNNQGKRPDQYENSAKFAWYAIVGMIVLLVAMTLFSGCSTTKKVDECCKTEKTSAK*
JGI25127J35165_111786613300002482MarineQGKRPDQYSNSAKFAWYGVVGMITLLILMTLLGGCSTTKKVDECCKSQKTSTK*
Ga0068515_11454033300004829Marine WaterMANLNNQGRSPEKYKNSAKAAWYATIGMIVLLIALTLFGGCSTTKKVDECCKTEKTSAK*
Ga0075474_1002956053300006025AqueousMENMNNQGKRKDQYESSAKFAWYAVVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK*
Ga0075478_1007255023300006026AqueousMENMNNQGKRKDQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK*
Ga0098038_104340423300006735MarineMANMNNQGKRPDQYSNSAKFAWYGVVGMITLLVLLTLLGGCSTTKKVDECCKSQKTSTK*
Ga0098042_112687313300006749MarineMENLNNQGRSPEKYKNSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDKCCTSADKIIEHYEKTSAK*
Ga0098042_115194623300006749MarineMENLNNQGKRPDQYENSAKFAGYSIMGMIILLIIVTLFGSCTTTKDTSIKKVDKCCKVDNKENKEC
Ga0098048_102856653300006752MarineMENLNNQGKRKDQYENSAKFAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK*
Ga0098048_106060333300006752MarineMANLNNQGKRKDQYENSAKFAWYAIVGMIVLLIALTLFGGCSTTKKVDECCKTEKTSAK*
Ga0075476_1006860133300006867AqueousMENMNNQGKRKNQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK*
Ga0070746_1014127523300006919AqueousMSFQQGKSKEKYESSAKAAWYAIVGMIVLLVAMTLFSGCSTTKKVDECCSKKESIK*
Ga0075460_1013366333300007234AqueousMNNQGKRKDQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK*
Ga0075463_1006790333300007236AqueousMNNQGKRKDQYESSAKFAWYAVVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK*
Ga0099846_100960953300007542AqueousMNNQGKRKNQFESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK*
Ga0098043_108252913300010148MarineMENLNNQGKRPDQYENSAKFAGYSIMGMIILLIIVTLFGSCTTTKDTSIKKVDKCCKVDNKENKECE*
Ga0098043_109242623300010148MarineMNNQGKRPDQYSNSAKFAWYGVVGMITLLVLLTLLGGCSTTKKVDECCKSQKTSTK*
Ga0098043_114907223300010148MarineMENLNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKTVVE*
Ga0098043_119133223300010148MarineMNNQGKRPDQYSNSAKFAWYGVVGMITLLVVLTLLGGCSTTKKVDECC
Ga0129348_125598923300010296Freshwater To Marine Saline GradientMNNRGKRKDQYESSAKFVWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK*
Ga0129351_103549633300010300Freshwater To Marine Saline GradientMNNQGKRKNQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK*
Ga0129351_133692123300010300Freshwater To Marine Saline GradientMANLNNQGKSPEKYENSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK*
Ga0160423_1037837523300012920Surface SeawaterMNNQGKRPDQYSNSAKFAWYGVVGMITLLVVLTLLGGCSTTKKIDECCKSQKTSTK*
Ga0160423_1064090523300012920Surface SeawaterMANLNNQGRSPEKYKNSAKAAWYAIVGMIVLLVATTLFGGCSTTKKVDECCSQKTSVK*
Ga0160423_1066059423300012920Surface SeawaterMKFQGKSKQNYENSAKAAWYAIVGMIVLLISMTLFNGCSTTKKVDECCSKKESIK*
Ga0160423_1098955513300012920Surface SeawaterMENLNNQGRSPEKYENSAKAAWYAIVGMIVLLIALTLFGGCSTTKKVDECCSQKTSVE*
Ga0163111_1230149123300012954Surface SeawaterMENLNNQGKSKQNYENSAKAAWYVIIGMISLLVLMTLFGGCSTTKKVDSCCSSKTVVE*
Ga0163111_1260289223300012954Surface SeawaterMENLNNQGRSPEKYKNSAKAAWYAIVGMIVLLVTMTLFNGCSTTKKVDECCSQKTSTK*
Ga0181377_1001960113300017706MarineMENMNNQGKRPDQYSNSAKFAWYSVVGMITLLIVLTLLGGCSTTKEVDSCCSPKTVVE
Ga0181377_102360423300017706MarineMENLNNQGRSPEKYKNSAKAAWYAIVGMIVLLVAMTLFGGCSITKKADKCCTSADKIIEHYEKTSAK
Ga0181377_102788743300017706MarineMKFQGKSKENYENSAKAAWYAMVGMIVLLISMTLFGGCSTTKKVDECCSKKESIK
Ga0181377_105217223300017706MarineMENLNNQGRSPEKYKNSAKAAWYAIVSMIVLLVAMTLFGGCSTTKKVDECCSQKTSVE
Ga0181369_104620123300017708MarineMENMNNQGKRPDQYSNSAKFAWYSVVGMITLLIVLTLLGGCSTTKEIDSCCSPKTVVE
Ga0181369_104685933300017708MarineMANMSNQGKDKQNYENSAKVAWYAIIGLTALLVLMTLFGGCSTTKKVDECCSLKTVIE
Ga0181369_109215133300017708MarineMENLNNQGRSPEKYENSAKAAWYAIVGMIVLLVAMTLFSGCSTTKKTDKCCTSADKIIEHYEKTSAK
Ga0181387_100312733300017709SeawaterMENMNNQGKRPDQYSNSAKFAWYGIVGMITLLILMTLLGGCSTTKKVDNCCSSKTVVE
Ga0181387_105025623300017709SeawaterMENLNNQGRSPEKYKNSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0181387_107710733300017709SeawaterKGPDQYGSSAKFAWYGVVGMITLLILMTLLGGCSTTKKVDECCQSKKTSTK
Ga0181387_109915623300017709SeawaterMENLNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKTVIE
Ga0181403_100349743300017710SeawaterMANLNNQGKRPDQYENSAKFAWYAIVGMIVLLVAVTLFSGCSTTKKVDECCKTEKTSAK
Ga0181391_103167013300017713SeawaterIYMENLNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKTVIE
Ga0181383_102001013300017720SeawaterIYMENMNNQGKGPDQYGSSAKFAWYGVVGMITLLILMTLLGGCSTTKKVDECCQSKKTST
Ga0181381_108716833300017726SeawaterMANLNNQGKRPDQYENSAKFAWYAIVGMIVLLVAVTLFSGCSTTKKVDECC
Ga0181401_106474213300017727SeawaterGKRPDQYENSAKFAWYAIVGMIVLLVAVTLFSGCSTTKKVDECCKTEKTSAK
Ga0181419_100583843300017728SeawaterMANLNNQGKRSDQYENSAKFAWYAIVGMIVLLVAVTLFSGCSTTKKVDECCKTEKTSAK
Ga0181419_106706733300017728SeawaterMENMNNQGKGPDQYGSSAKFAWYGVVGMITLLILMTLLGGCSTTKKVDECCQSKKTSTK
Ga0181417_101904733300017730SeawaterMENLNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKIVIE
Ga0181416_103685933300017731SeawaterMEKMNNQGKRPDQYSNSAKFAWYSVVGMITLLIVLTLLGGCLTTKEVDSCCSPKTVVE
Ga0181428_104358033300017738SeawaterMANMNNQGKRPDQYSNSAKFAWYSVVGMITLLIVLTLLGGCLTTKEVDSCCSPKTVVE
Ga0181433_106908633300017739SeawaterMSNQGKDKQNYKNSAKFAWYGVVGMITLLIVLTLFSGCVTTKKTDSCCSSKTVVE
Ga0181433_112717023300017739SeawaterMENMNNQGKGPDQYGNSAKFAWYGVVGMITLLILMTLLGGCSTTKKADSCCSSKTVVE
Ga0181418_116376123300017740SeawaterMENMNNQGKGPDQYGNSAKLAWYGVVGMITLLILMTLLGGCSTTKKVDKCCEAKNFNEEFFK
Ga0187219_117456833300017751SeawaterFVVIRCILYLVYMENLNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKTVIE
Ga0181408_103781413300017760SeawaterDQYENSAKFAWYAIVGMIVLLVAVTLFSGCSTTKKVDECCKTEKTSAK
Ga0181408_112561933300017760SeawaterMANLNNQGKRSDQYENSAKFAWYAIVGMIVLLVAVTLFSGCSTTKKVDECC
Ga0181422_114313533300017762SeawaterNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKTVIE
Ga0181410_118634713300017763SeawaterKQNYENSAKVAWYVIIGMISLLVLMTLFGGCSTTKKADSCCSSKTVIE
Ga0181385_104373543300017764SeawaterMENMNNQGKRPDQYSNSAKFAWYSVVGMITLLIVLTLLGGCLTTKEVDSCCSPKTVVE
Ga0181413_104365413300017765SeawaterKGPDQYGNSAKFAWYGVVGMITLLILMTLLGGCSTTKKADSCCSSKTVVE
Ga0187220_101849133300017768SeawaterMENLNNQGKSKQNYENSAKVAWYVIIGMISLLVLMTLFGGCLTTKKADSCCSSKTVIE
Ga0187221_119987623300017769SeawaterMENMNNQKKGSDQYGNSAKLAWYGVVGMITLLILMTLLGGCSTTKKVDKCCEAKNFNEEFFK
Ga0181577_1010712723300017951Salt MarshMANLNNQGKSPEKYENSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0181577_1067028723300017951Salt MarshMANLNNQGKRPDQYSNSAKFAWYGVVGMVTLLIVLTLLGGCSTTKKVDSCCSSKTVVE
Ga0181580_1095283723300017956Salt MarshMANLNNQGKSPEKYKNSAKAAWYAIIGMIVLLVAMTLFGGCSTTKKVDECCSSKTVVE
Ga0181590_1044761233300017967Salt MarshMANLNNQGKRPDQYENSAKFAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0181569_1071804623300017986Salt MarshLPHQNQNPLIHLISMANLNNQGKNPEKYENSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0181568_1112371833300018428Salt MarshMANLNNQGKNPEKYENSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0181556_110957123300020176Salt MarshMENLNNQGKGPEKYENSAKVAWYTIIGMIGLLVILTLLGGCSTTKKVDECCSSKTVVE
Ga0181556_114205633300020176Salt MarshMANLNNQGKSPEKYENSAKAAWYAIVGMIVLLIAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0211652_1010070633300020379MarineMKFQGKSKENYENSAKAAWYAIIGMVVLLVALTLFSGCSTTKKVDECCSKKESIK
Ga0211659_1051077123300020404MarineMANLNNQGRSPEKYKNSAKAAWYAIVGMIVLLVATTLFGGCSTTKKVDECCSQKTSVK
Ga0211523_1016472633300020414MarineMANMNNQGKRPDQYSNSAKFAWYGVVGMITLLILMTLLGGCSTTKKVDECCQSQKTSTK
Ga0211539_1045983823300020437MarineMNNQGKRPDQYSNSAKFAWYGVVGMITLLVLMTLLGGCSTTKKVDKCCQSQKTSTK
Ga0211558_1009299923300020439MarineMENLNNQGKRPDQYSNSAKFAWYGVIGMITLLVVLTLLGGCSTTKKVDSCCSSKTVVE
Ga0211559_1019579423300020442MarineMKFQGKSKQNYENSAKAAWYSMIGLLILLVGMTLFSNCSTTKKVDECCSKKESIK
Ga0211543_1017995723300020470MarineMANLNNQGKDKQNYENSAKIAWYAIIGLTALLVLMTLFGGCSTTKKVDECCSSKTVVE
Ga0213862_1022520123300021347SeawaterMANLNNQGKSPEKYKNSAKAAWYATIGMIVLLIALTLFGGCSTTKKVDECCKTEKTSAK
Ga0213866_1036752233300021425SeawaterMKFQGKSKEKYENSAKAAWYAIVGMVVLLVAMTLFSGCSTTKKVDECCSKKESIK
Ga0212030_100523433300022053AqueousMENMNNQGKRKDQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK
Ga0208667_101021343300025070MarineMENLNNQGKRKDQYENSAKFAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0208157_105471323300025086MarineMANMNNQGKRPDQYSNSAKFAWYGVVGMITLLVLLTLLGGCSTTKKVDECCKSQKTSTK
Ga0208434_102503633300025098MarineMANLNNQGKRKDQYENSAKFAWYAIVGMIVLLIALTLFGGCSTTKKVDECCKTEKTSAK
Ga0209348_100666963300025127MarineMANMNNQGKRSDQYSNSAKFAWYGVVGMITLLVLLTLLGGCSTTKKVDECCKSQKTSTK
Ga0209348_102047263300025127MarineMENMNNQGKRPDQYSNSAKFAWYGVVSMITLLILMTLLGGCSTTKKVDECCKSQKTSTK
Ga0209348_112669623300025127MarineMANLNNQGKRPDQYENSAKFAWYAIVGMIVLLVAMTLFSGCSTTKKVDECCKTEKTSAK
Ga0209645_104697843300025151MarineMANLNNQGKRPDQYENSAKAAWYAIVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSAK
Ga0209645_105345923300025151MarineMASMNNQGKRPDQYSNSAKFVWYGVVGMITLLILMTLLGGCSTTKKVDECCKSQKTSTK
Ga0209645_113791333300025151MarineMANLNNQGKRPDQYENSAKVAWYAIIGMIGLLVILTLLGGCSTTKKVDSCCSSKTVVE
Ga0209645_120187523300025151MarineMANLNNQGKSPEKYKNSAKAAWYAIVGMIVLLVTMTLFNGCSTTKKVDECCSQKTSTK
Ga0208019_111391133300025687AqueousMENMNNQGKRKNQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK
Ga0208150_126632813300025751AqueousMENMNNQGKRKDQYESSAKFAWYAVVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSA
Ga0208767_118861223300025769AqueousMSFQQGKSKEKYESSAKAAWYAIVGMIVLLVAMTLFSGCSTTKKVDECCSKKESIK
Ga0208542_113894513300025818AqueousMENMNNQGKRKDQYESSAKFAWYAVVGMIVLLVAMTLFGGCSTTKKVDECCKTEKTSVK
Ga0208547_120987523300025828AqueousMNNQGKRKDQYESSAKFAWYAVVGMITLLVLTTLFSGCSTTKKVDECCSTQKTSTK
Ga0135212_102153023300029306Marine HarborMENMNNQGKRPDQYSNSAKFAWYGVVGMVTLLIVLTLLGGCSTTKKVDSCCSSKTVVE
Ga0183748_100622163300029319MarineMENMNNQGKRPDQYSNSAKFAWYGVVGMITLLIILTLLGGCATTKETDSCCSPKTIVE
Ga0183748_101837833300029319MarineMASMNNQGKRPDQYENSAKFAWYGVVGMITLLIVLTLLGGCSTTKKVDKCCQSQKTSTK
Ga0183748_102370353300029319MarineMANLNNQGKSPEKYENSAKAAWYAIIGMIGLLVILTLLGGCSTTKKVDSCCSSKTVVE
Ga0183748_105538313300029319MarineMANLNNQGKRPDQYENSAKAAWYAIIGMIVLLVAMTLLGGCSTTKKVDECCKTQKTSTK
Ga0135210_102289023300029345Marine HarborMANMSNQGKDKQNYENSAKVAWYAIIGLTALLVLMTLFGGCSTTKKVDECCSSKTVVE

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.