Metagenome Family F103146

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F103146
Family Type	Metagenome
Number of Sequences	101
Average Sequence Length	39 residues
Representative Sequence	MSEPRYLMGDDYALNGVEGEEEETGDAGLPDRMWEDED
Number of Associated Samples	62
Number of Associated Scaffolds	101

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Unclassified
% of genes with valid RBS motifs	74.26 %
% of genes near scaffold ends (potentially truncated)	7.92 %
% of genes from short scaffolds (< 2000 bps)	65.35 %
Associated GOLD sequencing projects	58
AlphaFold2 3D model prediction	Yes
3D model pTM-score	0.21

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Unclassified (46.535 % of family members)
NCBI Taxonomy ID	N/A
Taxonomy	N/A

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake (28.713 % of family members)
Environment Ontology (ENVO)	Unclassified (66.337 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (78.218 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 7.58% β-sheet: 0.00% Coil/Unstructured: 92.42%
Feature Viewer

Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer


Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100	pTM-score: 0.21
Secondary Structure: α-helix β-sheet Coil Turn	pTM-score: 0.21
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF02467	Whib	22.77
PF00145	DNA_methylase	5.94
PF07659	DUF1599	3.96
PF08281	Sigma70_r4_2	2.97
PF13578	Methyltransf_24	2.97
PF09723	Zn-ribbon_8	1.98
PF03796	DnaB_C	0.99
PF07275	ArdA	0.99
PF04545	Sigma70_r4	0.99
PF00565	SNase	0.99
PF13230	GATase_4	0.99
PF12705	PDDEXK_1	0.99

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG0270	DNA-cytosine methylase	Replication, recombination and repair [L]	5.94
COG0305	Replicative DNA helicase	Replication, recombination and repair [L]	0.99
COG1066	DNA repair protein RadA/Sms, contains AAA+ ATPase domain	Replication, recombination and repair [L]	0.99
COG4734	Antirestriction protein ArdA	Defense mechanisms [V]	0.99

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	53.47 %
Unclassified	root	N/A	46.53 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
Viruses	superkingdom	All Organisms → Viruses	43.56 %
cellular organisms	root	All Organisms → cellular organisms	9.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
Duplodnaviria	clade	All Organisms → Viruses → Duplodnaviria	28.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.85 %
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	9.90 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
Heunggongvirae	kingdom	All Organisms → Viruses → Duplodnaviria → Heunggongvirae	28.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.85 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	4.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
Uroviricota	phylum	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota	28.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.85 %
Actinobacteria	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria	4.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
Caudoviricetes	class	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	28.71 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.85 %
Actinomycetia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia	4.95 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
environmental samples	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples	21.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.85 %
Streptosporangiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales	3.96 %
unclassified Caudoviricetes	no rank	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes	2.97 %
Frankiales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales	0.99 %

Name	Rank	Taxonomy	Distribution
Unclassified	root	N/A	46.53 %
uncultured Caudovirales phage	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	21.78 %
Predicted Viral	clade	All Organisms → Viruses → Predicted Viral	14.85 %
Streptosporangiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	3.96 %
Freshwater phage uvFW-CGR-AMD-COM-C440	species	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440	2.97 %
Frankiaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae	0.99 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002408\|B570J29032_109847501	Not Available	1627	Open in IMG/M
3300002835\|B570J40625_101400974	Not Available	577	Open in IMG/M
3300003411\|JGI25911J50253_10211698	Not Available	532	Open in IMG/M
3300005517\|Ga0070374_10040891	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	2407	Open in IMG/M
3300005517\|Ga0070374_10041770	Not Available	2381	Open in IMG/M
3300005517\|Ga0070374_10208553	All Organisms → Viruses → Predicted Viral	1004	Open in IMG/M
3300005517\|Ga0070374_10238729	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	931	Open in IMG/M
3300005517\|Ga0070374_10461121	Not Available	636	Open in IMG/M
3300005527\|Ga0068876_10020648	All Organisms → Viruses → Predicted Viral	4169	Open in IMG/M
3300005527\|Ga0068876_10026064	All Organisms → Viruses → Predicted Viral	3663	Open in IMG/M
3300005527\|Ga0068876_10088776	All Organisms → cellular organisms → Bacteria	1851	Open in IMG/M
3300005581\|Ga0049081_10027121	Not Available	2175	Open in IMG/M
3300005581\|Ga0049081_10117364	Not Available	986	Open in IMG/M
3300005584\|Ga0049082_10109031	Not Available	969	Open in IMG/M
3300005584\|Ga0049082_10267015	Not Available	576	Open in IMG/M
3300006639\|Ga0079301_1028289	All Organisms → cellular organisms → Bacteria	1906	Open in IMG/M
3300006805\|Ga0075464_10365107	All Organisms → cellular organisms → Bacteria	874	Open in IMG/M
3300007992\|Ga0105748_10305170	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	676	Open in IMG/M
3300008107\|Ga0114340_1011077	All Organisms → Viruses → Predicted Viral	4473	Open in IMG/M
3300008107\|Ga0114340_1016324	All Organisms → Viruses → Predicted Viral	3552	Open in IMG/M
3300008107\|Ga0114340_1227895	Not Available	591	Open in IMG/M
3300008107\|Ga0114340_1236846	Not Available	570	Open in IMG/M
3300008110\|Ga0114343_1056612	Not Available	2399	Open in IMG/M
3300008110\|Ga0114343_1114587	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	912	Open in IMG/M
3300008110\|Ga0114343_1161244	All Organisms → cellular organisms → Bacteria	701	Open in IMG/M
3300008110\|Ga0114343_1228960	Not Available	514	Open in IMG/M
3300008111\|Ga0114344_1225945	Not Available	566	Open in IMG/M
3300008114\|Ga0114347_1004549	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7910	Open in IMG/M
3300008114\|Ga0114347_1029784	All Organisms → cellular organisms → Bacteria	2481	Open in IMG/M
3300008114\|Ga0114347_1069570	All Organisms → Viruses → Predicted Viral	1438	Open in IMG/M
3300008116\|Ga0114350_1005306	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	10354	Open in IMG/M
3300008116\|Ga0114350_1010902	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5437	Open in IMG/M
3300008116\|Ga0114350_1071125	All Organisms → Viruses → Predicted Viral	1186	Open in IMG/M
3300008259\|Ga0114841_1248631	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440	583	Open in IMG/M
3300008266\|Ga0114363_1009050	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	5938	Open in IMG/M
3300008266\|Ga0114363_1173026	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	693	Open in IMG/M
3300008266\|Ga0114363_1178516	Not Available	676	Open in IMG/M
3300008448\|Ga0114876_1169132	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	776	Open in IMG/M
3300009068\|Ga0114973_10588682	Not Available	571	Open in IMG/M
3300009082\|Ga0105099_10683944	Not Available	635	Open in IMG/M
3300009155\|Ga0114968_10077152	All Organisms → Viruses → Predicted Viral	2077	Open in IMG/M
3300009161\|Ga0114966_10103304	All Organisms → Viruses → Predicted Viral	1913	Open in IMG/M
3300009180\|Ga0114979_10140363	Not Available	1482	Open in IMG/M
3300009183\|Ga0114974_10057956	Not Available	2574	Open in IMG/M
3300009183\|Ga0114974_10775159	Not Available	516	Open in IMG/M
3300009184\|Ga0114976_10382062	Not Available	739	Open in IMG/M
3300010160\|Ga0114967_10027861	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3833	Open in IMG/M
3300011115\|Ga0151514_10184	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	30769	Open in IMG/M
3300013372\|Ga0177922_10100833	Not Available	540	Open in IMG/M
3300013372\|Ga0177922_10929098	Not Available	597	Open in IMG/M
3300017723\|Ga0181362_1036117	All Organisms → Viruses → Predicted Viral	1048	Open in IMG/M
3300017723\|Ga0181362_1091582	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440	608	Open in IMG/M
3300017736\|Ga0181365_1065871	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	896	Open in IMG/M
3300017777\|Ga0181357_1243302	Not Available	627	Open in IMG/M
3300017778\|Ga0181349_1002556	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7812	Open in IMG/M
3300017778\|Ga0181349_1134420	Not Available	901	Open in IMG/M
3300017780\|Ga0181346_1254097	Not Available	613	Open in IMG/M
3300017784\|Ga0181348_1146095	Not Available	889	Open in IMG/M
3300019784\|Ga0181359_1008186	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3602	Open in IMG/M
3300019784\|Ga0181359_1077893	All Organisms → Viruses → Predicted Viral	1246	Open in IMG/M
3300019784\|Ga0181359_1160097	Not Available	763	Open in IMG/M
3300019784\|Ga0181359_1187173	Not Available	678	Open in IMG/M
3300020159\|Ga0211734_10560816	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	576	Open in IMG/M
3300020159\|Ga0211734_11277619	Not Available	949	Open in IMG/M
3300020161\|Ga0211726_11060716	All Organisms → Viruses → Predicted Viral	1706	Open in IMG/M
3300020533\|Ga0208364_1000044	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	33490	Open in IMG/M
3300020560\|Ga0208852_1005101	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Frankiales → Frankiaceae	2997	Open in IMG/M
3300021963\|Ga0222712_10013610	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	7150	Open in IMG/M
3300021963\|Ga0222712_10369230	Not Available	880	Open in IMG/M
3300022190\|Ga0181354_1014874	Not Available	2379	Open in IMG/M
3300022190\|Ga0181354_1167032	Not Available	678	Open in IMG/M
3300022407\|Ga0181351_1066405	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	1471	Open in IMG/M
3300022752\|Ga0214917_10012067	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7888	Open in IMG/M
3300023184\|Ga0214919_10585151	Not Available	663	Open in IMG/M
3300027114\|Ga0208009_1081381	Not Available	541	Open in IMG/M
3300027563\|Ga0209552_1143048	Not Available	619	Open in IMG/M
3300027608\|Ga0208974_1009801	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	3141	Open in IMG/M
3300027734\|Ga0209087_1306149	Not Available	564	Open in IMG/M
3300027754\|Ga0209596_1165683	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	970	Open in IMG/M
3300027759\|Ga0209296_1304071	Not Available	632	Open in IMG/M
3300027759\|Ga0209296_1390337	Not Available	524	Open in IMG/M
3300027764\|Ga0209134_10091906	Not Available	1034	Open in IMG/M
3300027764\|Ga0209134_10202068	Not Available	684	Open in IMG/M
3300027770\|Ga0209086_10264124	Not Available	753	Open in IMG/M
3300027816\|Ga0209990_10017134	All Organisms → Viruses → Predicted Viral	4187	Open in IMG/M
3300027816\|Ga0209990_10174923	All Organisms → Viruses → Predicted Viral	1006	Open in IMG/M
3300028025\|Ga0247723_1006179	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5273	Open in IMG/M
3300028025\|Ga0247723_1006352	Not Available	5182	Open in IMG/M
3300028025\|Ga0247723_1080740	Not Available	856	Open in IMG/M
3300031758\|Ga0315907_10014058	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	7707	Open in IMG/M
3300031758\|Ga0315907_10024743	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5499	Open in IMG/M
3300031758\|Ga0315907_10033830	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes	4590	Open in IMG/M
3300031784\|Ga0315899_10007696	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	11574	Open in IMG/M
3300031787\|Ga0315900_10316298	All Organisms → Viruses → Predicted Viral	1283	Open in IMG/M
3300031857\|Ga0315909_10026583	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	5702	Open in IMG/M
3300031857\|Ga0315909_10732628	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Freshwater phage uvFW-CGR-AMD-COM-C440	636	Open in IMG/M
3300031951\|Ga0315904_10007114	All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → environmental samples → uncultured Caudovirales phage	15097	Open in IMG/M
3300031951\|Ga0315904_10336996	Not Available	1395	Open in IMG/M
3300033993\|Ga0334994_0340624	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae	746	Open in IMG/M
3300034062\|Ga0334995_0042962	Not Available	3759	Open in IMG/M
3300034092\|Ga0335010_0181159	Not Available	1304	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	95.05%
Terrestrial	Environmental → Terrestrial	4.95%

Habitat	Taxonomy	Distribution
Freshwater	Environmental → Aquatic → Freshwater	91.09%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface	4.95%
Marine	Environmental → Aquatic → Marine	3.96%

Habitat	Taxonomy	Distribution
Lake	Environmental → Aquatic → Freshwater → Lake	43.56%
Lentic	Environmental → Aquatic → Freshwater → Lentic	37.62%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified	8.91%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified	4.95%
Coastal	Environmental → Aquatic → Marine → Coastal	1.98%
Unclassified	Environmental → Aquatic → Marine → Unclassified	1.98%
Sediment	Environmental → Aquatic → Freshwater → Sediment	0.99%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Freshwater → Lake → Unclassified	43.56%
Unclassified	Environmental → Aquatic → Freshwater → Lentic → Unclassified	34.65%
Unclassified	Environmental → Aquatic → Freshwater → Unclassified → Unclassified	8.91%
Unclassified	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified	4.95%
Epilimnion	Environmental → Aquatic → Freshwater → Lentic → Epilimnion	2.97%
Unclassified	Environmental → Aquatic → Marine → Coastal → Unclassified	1.98%
Unclassified	Environmental → Aquatic → Marine → Unclassified → Unclassified	1.98%
Unclassified	Environmental → Aquatic → Freshwater → Sediment → Unclassified	0.99%

Habitat	Taxonomy	Distribution
Freshwater Lake	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake	28.71%
Freshwater, Plankton	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton	18.81%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	12.87%
Freshwater	Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater	8.91%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	5.94%
Freshwater Lentic	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic	4.95%
Freshwater	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater	4.95%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater	2.97%
Deep Subsurface Sediment	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface Sediment	2.97%
Estuarine Water	Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water	1.98%
Deep Subsurface	Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface	1.98%
Freshwater Sediment	Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment	0.99%
Freshwater	Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater	0.99%
Freshwater Lake	Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake	0.99%
Aqueous	Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous	0.99%
Estuary Water	Environmental → Aquatic → Marine → Coastal → Unclassified → Estuary Water	0.99%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002408	Freshwater microbial communities from Lake Mendota, WI, sample - 15JUL2010 deep hole epilimnion (Lake Mendota Combined assembly, ASSEMBLY_DATE=20140123)	Environmental	Open in IMG/M
3300002835	Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605)	Environmental	Open in IMG/M
3300003411	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MM110.SD	Environmental	Open in IMG/M
3300005517	Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (version 4)	Environmental	Open in IMG/M
3300005527	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG	Environmental	Open in IMG/M
3300005581	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF	Environmental	Open in IMG/M
3300005584	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG HU45MSRF	Environmental	Open in IMG/M
3300006639	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11	Environmental	Open in IMG/M
3300006805	Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_<0.8_DNA	Environmental	Open in IMG/M
3300007992	Coastal water column microbial communities from Columbia River Estuary, Oregon, USA - CMOP_DNA_1461AB_0.2um	Environmental	Open in IMG/M
3300008107	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA	Environmental	Open in IMG/M
3300008110	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0048-3-NA	Environmental	Open in IMG/M
3300008111	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-C-NA	Environmental	Open in IMG/M
3300008114	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-C-NA	Environmental	Open in IMG/M
3300008116	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0106-3-NA	Environmental	Open in IMG/M
3300008259	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, sample HABS-E2014-0132-C-NA	Environmental	Open in IMG/M
3300008266	Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA	Environmental	Open in IMG/M
3300008448	Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs	Environmental	Open in IMG/M
3300009068	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_140807_MF_MetaG	Environmental	Open in IMG/M
3300009082	Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015	Environmental	Open in IMG/M
3300009155	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_EF_MetaG	Environmental	Open in IMG/M
3300009161	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG	Environmental	Open in IMG/M
3300009180	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_140625_EF_MetaG	Environmental	Open in IMG/M
3300009183	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG	Environmental	Open in IMG/M
3300009184	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG	Environmental	Open in IMG/M
3300010160	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130628_MF_MetaG	Environmental	Open in IMG/M
3300011115	Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2016May	Environmental	Open in IMG/M
3300013372	Freshwater microbial communities from Lake Erie, Ontario, Canada. Combined Assembly of 10 SPs	Environmental	Open in IMG/M
3300017723	Freshwater viral communities from Lake Michigan, USA - Su13.ND.MM110.S.N	Environmental	Open in IMG/M
3300017736	Freshwater viral communities from Lake Michigan, USA - Fa13.ND.MM110.D.N	Environmental	Open in IMG/M
3300017777	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM110.D.N	Environmental	Open in IMG/M
3300017778	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.S.D	Environmental	Open in IMG/M
3300017780	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.D.N	Environmental	Open in IMG/M
3300017784	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM110.D.N	Environmental	Open in IMG/M
3300019784	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.D	Environmental	Open in IMG/M
3300020159	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1	Environmental	Open in IMG/M
3300020161	Freshwater lake microbial communities from Lake Erken, Sweden - P4710_101 megahit1	Environmental	Open in IMG/M
3300020533	Freshwater microbial communities from Lake Mendota, WI - 08JUN2012 deep hole epilimnion (SPAdes)	Environmental	Open in IMG/M
3300020560	Freshwater microbial communities from Lake Mendota, WI - 18JUN2009 deep hole epilimnion ns (SPAdes)	Environmental	Open in IMG/M
3300021963	Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D	Environmental	Open in IMG/M
3300022190	Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MM15.S.N	Environmental	Open in IMG/M
3300022407	Freshwater viral communities from Lake Michigan, USA - Su13.VD.MM15.S.D	Environmental	Open in IMG/M
3300022752	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB	Environmental	Open in IMG/M
3300023184	Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL-1503	Environmental	Open in IMG/M
3300027114	Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_16 (SPAdes)	Environmental	Open in IMG/M
3300027563	Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MM15.SD (SPAdes)	Environmental	Open in IMG/M
3300027608	Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER15MSRF (SPAdes)	Environmental	Open in IMG/M
3300027734	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130805_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027754	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130807_MF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027759	Freshwater microbial communities from Lake Simoncouche, Canada to study carbon cycling - S_130206_EF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027764	Freshwater lake microbial communities from Lake Michigan, USA - Sp13.BD.MLB.SN (SPAdes)	Environmental	Open in IMG/M
3300027770	Freshwater microbial communities from Lake Montjoie, Canada to study carbon cycling - M_130207_XF_MetaG (SPAdes)	Environmental	Open in IMG/M
3300027816	Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes)	Environmental	Open in IMG/M
3300028025	Subsurface sediment microbial communities from gas well in West Virginia, United States - MSEEL Well Study Marcellus 5H_FC	Environmental	Open in IMG/M
3300031758	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123	Environmental	Open in IMG/M
3300031784	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112	Environmental	Open in IMG/M
3300031787	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA114	Environmental	Open in IMG/M
3300031857	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125	Environmental	Open in IMG/M
3300031951	Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120	Environmental	Open in IMG/M
3300033993	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME20Jul2012-rr0037	Environmental	Open in IMG/M
3300034062	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME27Jul2012-rr0045	Environmental	Open in IMG/M
3300034092	Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME03Aug2012-rr0069	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
B570J29032_1098475015	3300002408	Freshwater	MAEPRYLMGDDYALNGVEGEEEIGDTGLPDRMWEDED*
B570J40625_1014009741	3300002835	Freshwater	MTMSEPMYLMGDDYALKGDESDVDENDDSGLPDRMWEDDV*
JGI25911J50253_102116982	3300003411	Freshwater Lake	VRERGSGPMAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED*
Ga0070374_100408915	3300005517	Freshwater Lake	MSEPMYLMGDEFALKGEEEDEDDSGLPDRMWEDDL*
Ga0070374_100417702	3300005517	Freshwater Lake	MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED*
Ga0070374_102085534	3300005517	Freshwater Lake	VSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED*
Ga0070374_102387293	3300005517	Freshwater Lake	MSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE*
Ga0070374_104611211	3300005517	Freshwater Lake	MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE*
Ga0068876_100206485	3300005527	Freshwater Lake	MSEPMYLMGDDYALNGTEDDVDENDTGLPDRMWEDDE*
Ga0068876_100260648	3300005527	Freshwater Lake	MSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEDA*
Ga0068876_100887764	3300005527	Freshwater Lake	MKGKHMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA*
Ga0049081_100271215	3300005581	Freshwater Lentic	MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWEDED*
Ga0049081_101173645	3300005581	Freshwater Lentic	VSEPMYLMGDEFALKGEEEDEDDSGLPDRMWEDDL*
Ga0049082_101090312	3300005584	Freshwater Lentic	VLEVWGSQLMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE*
Ga0049082_102670152	3300005584	Freshwater Lentic	MAEPRYLFGDDYALNGVEGEEEEIGDAGLPDRMSEDED*
Ga0079301_10282897	3300006639	Deep Subsurface	MSEPRYLEGDEYALNGIEGEEEDTGDTGLPDRMWEDEE*
Ga0075464_103651072	3300006805	Aqueous	VSEPRYLEGDDYALNGVEGEDEDAGDTGLPDRMWEDED*
Ga0105748_103051702	3300007992	Estuary Water	MSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA*
Ga0114340_101107712	3300008107	Freshwater, Plankton	MKMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA*
Ga0114340_10163244	3300008107	Freshwater, Plankton	MSEPMYLQGDDYALNGTEEDIDENDTGLPDRMWEDEDA*
Ga0114340_12278952	3300008107	Freshwater, Plankton	LITIRRKLMPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDED*
Ga0114340_12368462	3300008107	Freshwater, Plankton	MKGRRMSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEDA*
Ga0114343_10566121	3300008110	Freshwater, Plankton	MPEPRYLMGDEYALNGIEGEEEDTGDTGLPDRMWEDEE*
Ga0114343_11145872	3300008110	Freshwater, Plankton	MSEPMYLQGDEYALKGIEGDIDEDDDSGLPDRMWEDDE*
Ga0114343_11612442	3300008110	Freshwater, Plankton	MPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDED*
Ga0114343_12289602	3300008110	Freshwater, Plankton	MPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDEE*
Ga0114344_12259454	3300008111	Freshwater, Plankton	MKMSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEE*
Ga0114347_10045492	3300008114	Freshwater, Plankton	MSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDDE*
Ga0114347_10297845	3300008114	Freshwater, Plankton	MGEPRYLSGDEYARNGVEGEEEETGDAGLPDRMWEDED*
Ga0114347_10695703	3300008114	Freshwater, Plankton	MKGKRMSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEDA*
Ga0114350_10053068	3300008116	Freshwater, Plankton	MKGKHMSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEDA*
Ga0114350_10109029	3300008116	Freshwater, Plankton	MKGKHMNEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA*
Ga0114350_10711252	3300008116	Freshwater, Plankton	MYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA*
Ga0114841_12486313	3300008259	Freshwater, Plankton	MSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEE*
Ga0114363_10090508	3300008266	Freshwater, Plankton	MGEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED*
Ga0114363_11730262	3300008266	Freshwater, Plankton	MSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEE*
Ga0114363_11785162	3300008266	Freshwater, Plankton	MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDDE*
Ga0114876_11691321	3300008448	Freshwater Lake	MSEPMYLQGDEYALKGIEGDIDENDDSGLPDRMWEDDE*
Ga0114973_105886822	3300009068	Freshwater Lake	VRERRSGPMAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWEDED*
Ga0105099_106839441	3300009082	Freshwater Sediment	MPEPRYLEGDDYALNGVEQEDEDTGDTGEPDRMWEDEE*
Ga0114968_100771527	3300009155	Freshwater Lake	MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDD*
Ga0114966_101033046	3300009161	Freshwater Lake	MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDE*
Ga0114979_101403632	3300009180	Freshwater Lake	VRERGSKPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED*
Ga0114974_100579566	3300009183	Freshwater Lake	VRERRSGPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED*
Ga0114974_107751592	3300009183	Freshwater Lake	VRERGSGPMAEPRYLMGDDYALNGVEGEEEEIGDVGLPDRMSEDED*
Ga0114976_103820624	3300009184	Freshwater Lake	EPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED*
Ga0114967_100278614	3300010160	Freshwater Lake	MGEPRYLSGDEYALNGVEGEEEEIGDAGLPDRMWEDED*
Ga0151514_101842	3300011115	Freshwater	MSEPRYLEGDEAALNTEPESDDDDSGLPDRMWEDDE*
Ga0177922_101008333	3300013372	Freshwater	MSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED*
Ga0177922_109290982	3300013372	Freshwater	VRERGSGPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMSEDED*
Ga0181362_10361175	3300017723	Freshwater Lake	MREPMYLMGDEFALKGEEEDEGDSGLPDRMWEDDE
Ga0181362_10915821	3300017723	Freshwater Lake	MGEPRYLMGDDYALNGVEGEEEIGDAGLPDRMGEDED
Ga0181365_10658712	3300017736	Freshwater Lake	VLEVWGSQLMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE
Ga0181357_12433023	3300017777	Freshwater Lake	MGEPRYLMGDDYALNGVEGEEEETGDAGLPDRMWEDDY
Ga0181349_100255610	3300017778	Freshwater Lake	MSEPMYLQGEEYALNGTEDDVDENDTGLPDRMWEDEE
Ga0181349_11344205	3300017778	Freshwater Lake	VSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWE
Ga0181346_12540973	3300017780	Freshwater Lake	PRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED
Ga0181348_11460955	3300017784	Freshwater Lake	MGEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWE
Ga0181359_10081869	3300019784	Freshwater Lake	MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED
Ga0181359_10778931	3300019784	Freshwater Lake	MSEPMYLMGDEFALKGEEEDEDDSGLPDRMWEDDL
Ga0181359_11600973	3300019784	Freshwater Lake	VSEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED
Ga0181359_11871734	3300019784	Freshwater Lake	MSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE
Ga0211734_105608161	3300020159	Freshwater	VSEPMYLMGDDYALKGDESDIDENDDSGLPDRMWEDEL
Ga0211734_112776194	3300020159	Freshwater	MSEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED
Ga0211726_110607162	3300020161	Freshwater	MSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDEL
Ga0208364_10000445	3300020533	Freshwater	MKGKRMSEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEDA
Ga0208852_10051014	3300020560	Freshwater	MAEPRYLMGDDYALNGVEGEEEIGDTGLPDRMWEDED
Ga0222712_1001361012	3300021963	Estuarine Water	VSEPRYLMGDDYALNGVEGEEEEIGDTGLPDRMWEDED
Ga0222712_103692304	3300021963	Estuarine Water	MSEPRYLMGDDYALNGVEGEEEETGDAGLPDRMWEDED
Ga0181354_101487410	3300022190	Freshwater Lake	MAEPRYLFGDDYALNGVEGEEEEIGDAGLPDRMSEDED
Ga0181354_11670321	3300022190	Freshwater Lake	MGEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED
Ga0181351_10664055	3300022407	Freshwater Lake	VRERGSGPMAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMSEDED
Ga0214917_1001206714	3300022752	Freshwater	MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDE
Ga0214919_105851511	3300023184	Freshwater	WRPIMSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDE
Ga0208009_10813812	3300027114	Deep Subsurface	MSEPRYLEGDEYALNGIEGEEEDTGDTGLPDRMWEDEE
Ga0209552_11430481	3300027563	Freshwater Lake	MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWE
Ga0208974_10098016	3300027608	Freshwater Lentic	MAEPRYLMGDDYALNGVEGEEEEIGDAGLPDRMWEDED
Ga0209087_13061491	3300027734	Freshwater Lake	MAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED
Ga0209596_11656833	3300027754	Freshwater Lake	MSEPRYLEGDEAALNTEPETDNDDDDSGLPDRMWEDD
Ga0209296_13040713	3300027759	Freshwater Lake	VRERGSKPMAEPRYLMGDDYALNGVEGEEEIGDAGLPDRMWEDED
Ga0209296_13903371	3300027759	Freshwater Lake	MAEPRYLMGDDYALNGVEGEEEEIGDVGLPDRMSEDED
Ga0209134_100919066	3300027764	Freshwater Lake	MSEPRYLSGDEYALNGVEGEEEIGDAGLPDRMWEDED
Ga0209134_102020681	3300027764	Freshwater Lake	MSEPRYLEGDEYALNGIEGEGEEEDTGDTGLPDRMWEDEE
Ga0209086_102641242	3300027770	Freshwater Lake	MGEPRYLSGDEYALNGVEGEEEETGDAGLPDRMWEDED
Ga0209990_100171348	3300027816	Freshwater Lake	MSEPMYLMGDDYALNGTEDDVDENDTGLPDRMWEDDE
Ga0209990_101749232	3300027816	Freshwater Lake	MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDEE
Ga0247723_10061793	3300028025	Deep Subsurface Sediment	MSEPMYLQGDEYALKGIEGDIDENDDSGLPDRMWEDDE
Ga0247723_100635211	3300028025	Deep Subsurface Sediment	MPEPRYLEGDDYALNGVEGEEESDTGDTGEPDRMWEDEE
Ga0247723_10807405	3300028025	Deep Subsurface Sediment	MSEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDEE
Ga0315907_100140586	3300031758	Freshwater	MLGLWGAQLMSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDDE
Ga0315907_100247432	3300031758	Freshwater	VSEPMYLQGDDYALNGTEDDIDENDTGLPDRMWEDEE
Ga0315907_1003383011	3300031758	Freshwater	MKGKHMSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEDA
Ga0315899_1000769612	3300031784	Freshwater	MGLWGAQLMSEPMYLMGDDYALNGTEDDVDENDTGLPDRMWEDDE
Ga0315900_103162984	3300031787	Freshwater	MPEPRYLEGDDYALNGVEGEEEEAGDTGLPDRMWEDED
Ga0315909_1002658311	3300031857	Freshwater	MSEPMYLMGDEYALKGTEDDVDENDDSGLPDRMWEDDE
Ga0315909_107326281	3300031857	Freshwater	MGEPMYLQGDDYALNGTEDDVDENDTGLPDRMWEDDE
Ga0315904_1000711419	3300031951	Freshwater	MSEPMYLQGDDYALNGTEDDIDEDDTGLPDRMWEDEDA
Ga0315904_103369963	3300031951	Freshwater	MSEPRYLEGDPYALTGVEGDDEEDDSGLPDRMWEDLD
Ga0334994_0340624_409_525	3300033993	Freshwater	MSEPMYLMGDDYALKGDESDVDENDDSGLPDRMWEDDV
Ga0334995_0042962_136_252	3300034062	Freshwater	MPEPRYLGGDDYALNGVEGEEEEAGDTGLPDRMWEDEE
Ga0335010_0181159_1193_1303	3300034092	Freshwater	MSEPRYLEGDEYALNGIEGEGEEEDTGDTGLPDRMWE

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome Family F103146

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Predicted 3D Structure

Low Quality Model:

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences