Metagenome / Metatranscriptome Family F103323

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F103323
Family Type	Metagenome / Metatranscriptome
Number of Sequences	101
Average Sequence Length	45 residues
Representative Sequence	SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA
Number of Associated Samples	65
Number of Associated Scaffolds	101

Quality Assessment
Transcriptomic Evidence	Yes
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	0.00 %
% of genes near scaffold ends (potentially truncated)	100.00 %
% of genes from short scaffolds (< 2000 bps)	91.09 %
Associated GOLD sequencing projects	59
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (92.079 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat (51.485 % of family members)
Environment Ontology (ENVO)	Unclassified (99.010 % of family members)
Earth Microbiome Project Ontology (EMPO)	Unclassified (51.485 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 101 Family Scaffolds
PF04851	ResIII	2.97
PF01738	DLH	2.97
PF12850	Metallophos_2	2.97
PF00496	SBP_bac_5	1.98
PF13366	PDDEXK_3	1.98
PF03787	RAMPs	1.98
PF01370	Epimerase	1.98
PF03466	LysR_substrate	0.99
PF00300	His_Phos_1	0.99
PF00072	Response_reg	0.99
PF13088	BNR_2	0.99
PF00149	Metallophos	0.99
PF03681	Obsolete Pfam Family	0.99
PF14344	DUF4397	0.99
PF04932	Wzy_C	0.99
PF00005	ABC_tran	0.99
PF02782	FGGY_C	0.99
PF13304	AAA_21	0.99
PF07676	PD40	0.99
PF09455	Cas_DxTHG	0.99
PF13242	Hydrolase_like	0.99
PF00999	Na_H_Exchanger	0.99
PF00465	Fe-ADH	0.99
PF12697	Abhydrolase_6	0.99
PF07927	HicA_toxin	0.99
PF04545	Sigma70_r4	0.99
PF02254	TrkA_N	0.99

COG ID	Name	Functional Category	% Frequency in 101 Family Scaffolds
COG1332	CRISPR-Cas system type III CSM-effector complex subunit Csm5, RAMP superfamily Cas7 group	Defense mechanisms [V]	1.98
COG1336	CRISPR-Cas system type III CMR-effector complex subunit Cmr4, RAMP superfamily Cas7 group	Defense mechanisms [V]	1.98
COG1337	CRISPR-Cas system type III CSM-effector complex subunit Csm3, RAMP superfamily Cas7 group	Defense mechanisms [V]	1.98
COG1367	CRISPR-Cas system type III CMR-effector complex subunit Cmr1, RAMP superfamily Cas7 group	Defense mechanisms [V]	1.98
COG1567	CRISPR-Cas system type III CSM-effector complex subunit Csm4, RAMP superfamily Cas5 group	Defense mechanisms [V]	1.98
COG1604	CRISPR/Cas system CMR subunit Cmr6, Cas7 group, RAMP superfamily	Defense mechanisms [V]	1.98
COG0025	NhaP-type Na+/H+ or K+/H+ antiporter	Inorganic ion transport and metabolism [P]	0.99
COG0337	3-dehydroquinate synthetase	Amino acid transport and metabolism [E]	0.99
COG0371	Glycerol dehydrogenase or related enzyme, iron-containing ADH family	Energy production and conversion [C]	0.99
COG0475	Kef-type K+ transport system, membrane component KefB	Inorganic ion transport and metabolism [P]	0.99
COG1454	Alcohol dehydrogenase, class IV	Energy production and conversion [C]	0.99
COG1724	Predicted RNA binding protein YcfA, dsRBD-like fold, HicA-like mRNA interferase family	General function prediction only [R]	0.99
COG1979	Alcohol dehydrogenase YqhD, Fe-dependent ADH family	Energy production and conversion [C]	0.99
COG3004	Na+/H+ antiporter NhaA	Energy production and conversion [C]	0.99
COG3263	NhaP-type Na+/H+ and K+/H+ antiporter with C-terminal TrkAC and CorC domains	Energy production and conversion [C]	0.99
COG3307	O-antigen ligase	Cell wall/membrane/envelope biogenesis [M]	0.99
COG4651	Predicted Kef-type K+ transport protein, K+/H+ antiporter domain	Inorganic ion transport and metabolism [P]	0.99

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	92.08 %
Unclassified	root	N/A	7.92 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	92.08 %
Unclassified	root	N/A	7.92 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	92.08 %
Unclassified	root	N/A	7.92 %

Name	Rank	Taxonomy	Distribution
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	72.28 %
Unclassified	root	N/A	7.92 %

Name	Rank	Taxonomy	Distribution
Chloroflexi	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	66.34 %
Unclassified	root	N/A	7.92 %

Name	Rank	Taxonomy	Distribution
Chloroflexia	class	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia	43.56 %
Unclassified	root	N/A	7.92 %
unclassified Chloroflexi	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi	4.95 %

Name	Rank	Taxonomy	Distribution
Chloroflexales	order	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	43.56 %
Unclassified	root	N/A	7.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.95 %

Name	Rank	Taxonomy	Distribution
Roseiflexineae	suborder	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae	42.57 %
Unclassified	root	N/A	7.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.95 %

Name	Rank	Taxonomy	Distribution
Roseiflexaceae	family	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae	42.57 %
Unclassified	root	N/A	7.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.95 %

Name	Rank	Taxonomy	Distribution
Roseiflexus	genus	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus	42.57 %
Unclassified	root	N/A	7.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.95 %

Name	Rank	Taxonomy	Distribution
unclassified Roseiflexus	no rank	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus	41.58 %
Unclassified	root	N/A	7.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.95 %

Name	Rank	Taxonomy	Distribution
Roseiflexus sp. RS-1	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	41.58 %
Unclassified	root	N/A	7.92 %
Chloroflexi bacterium	species	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	4.95 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002493\|JGI24185J35167_1034919	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus	1165	Open in IMG/M
3300005240\|Ga0068641_129498	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1280	Open in IMG/M
3300005241\|Ga0068642_110773	All Organisms → cellular organisms → Bacteria	553	Open in IMG/M
3300005242\|Ga0068639_118177	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	552	Open in IMG/M
3300005243\|Ga0068643_1006368	All Organisms → cellular organisms → Bacteria	3135	Open in IMG/M
3300005243\|Ga0068643_1014918	All Organisms → cellular organisms → Bacteria	556	Open in IMG/M
3300005245\|Ga0068640_110268	All Organisms → cellular organisms → Bacteria → Terrabacteria group	815	Open in IMG/M
3300005245\|Ga0068640_133574	All Organisms → cellular organisms → Bacteria	907	Open in IMG/M
3300005247\|Ga0068637_1015166	All Organisms → cellular organisms → Bacteria	1226	Open in IMG/M
3300005247\|Ga0068637_1015348	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	748	Open in IMG/M
3300005250\|Ga0068635_1068360	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1020	Open in IMG/M
3300005251\|Ga0068634_1061962	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	979	Open in IMG/M
3300005411\|Ga0068647_1027291	All Organisms → cellular organisms → Bacteria	570	Open in IMG/M
3300005413\|Ga0068633_1047224	All Organisms → cellular organisms → Bacteria	650	Open in IMG/M
3300005452\|Ga0068706_1096647	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	516	Open in IMG/M
3300005453\|Ga0068705_10090530	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	840	Open in IMG/M
3300005490\|Ga0068662_105771	All Organisms → cellular organisms → Bacteria	527	Open in IMG/M
3300005494\|Ga0068668_1009187	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	519	Open in IMG/M
3300005494\|Ga0068668_1021758	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	864	Open in IMG/M
3300005495\|Ga0068666_1012467	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	869	Open in IMG/M
3300005495\|Ga0068666_1025114	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300005495\|Ga0068666_1026807	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1172	Open in IMG/M
3300005499\|Ga0068667_1027704	All Organisms → cellular organisms → Bacteria → Terrabacteria group	934	Open in IMG/M
3300005499\|Ga0068667_1042914	All Organisms → cellular organisms → Bacteria	1658	Open in IMG/M
3300005638\|Ga0068669_1073921	All Organisms → cellular organisms → Bacteria	572	Open in IMG/M
3300006380\|Ga0068664_1119559	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	595	Open in IMG/M
3300006848\|Ga0101768_1023664	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	676	Open in IMG/M
3300006848\|Ga0101768_1057370	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	517	Open in IMG/M
3300006849\|Ga0102029_1223846	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	745	Open in IMG/M
3300006849\|Ga0102029_1229293	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	567	Open in IMG/M
3300007000\|Ga0102499_1147404	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	531	Open in IMG/M
3300010176\|Ga0124933_155720	All Organisms → cellular organisms → Bacteria	541	Open in IMG/M
3300010179\|Ga0124936_1096654	All Organisms → cellular organisms → Bacteria	1298	Open in IMG/M
3300010181\|Ga0124926_1078131	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	2577	Open in IMG/M
3300010183\|Ga0124919_1143618	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	641	Open in IMG/M
3300010186\|Ga0124916_1015669	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	502	Open in IMG/M
3300010191\|Ga0124914_1197049	Not Available	752	Open in IMG/M
3300010193\|Ga0124924_1114208	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	1641	Open in IMG/M
3300010246\|Ga0124932_105912	All Organisms → cellular organisms → Bacteria	597	Open in IMG/M
3300010251\|Ga0124940_1061987	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1595	Open in IMG/M
3300010256\|Ga0124939_1187297	Not Available	582	Open in IMG/M
3300020153\|Ga0197142_1037960	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	2054	Open in IMG/M
3300026237\|Ga0209750_1038536	All Organisms → cellular organisms → Bacteria	915	Open in IMG/M
3300026237\|Ga0209750_1070974	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	610	Open in IMG/M
3300026237\|Ga0209750_1071631	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	606	Open in IMG/M
3300026509\|Ga0209809_1031618	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	1869	Open in IMG/M
3300027279\|Ga0209691_1010907	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	2831	Open in IMG/M
3300027279\|Ga0209691_1067277	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	641	Open in IMG/M
3300028761\|Ga0272447_1063781	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	530	Open in IMG/M
3300031245\|Ga0308395_1010348	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	3689	Open in IMG/M
3300031245\|Ga0308395_1056326	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	1006	Open in IMG/M
3300031245\|Ga0308395_1087693	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	729	Open in IMG/M
3300031245\|Ga0308395_1100453	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	662	Open in IMG/M
3300031508\|Ga0308394_1079983	Not Available	692	Open in IMG/M
3300031508\|Ga0308394_1083940	Not Available	668	Open in IMG/M
3300031508\|Ga0308394_1088623	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	643	Open in IMG/M
3300031508\|Ga0308394_1089947	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	636	Open in IMG/M
3300031509\|Ga0308399_1023555	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales	1535	Open in IMG/M
3300031509\|Ga0308399_1081236	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	663	Open in IMG/M
3300031512\|Ga0308397_1031884	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	1415	Open in IMG/M
3300031512\|Ga0308397_1065318	All Organisms → cellular organisms → Bacteria → Terrabacteria group	843	Open in IMG/M
3300031512\|Ga0308397_1093176	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	654	Open in IMG/M
3300031512\|Ga0308397_1100598	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	620	Open in IMG/M
3300031512\|Ga0308397_1126208	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	530	Open in IMG/M
3300031513\|Ga0308412_1111728	All Organisms → cellular organisms → Bacteria → Terrabacteria group	805	Open in IMG/M
3300031513\|Ga0308412_1121015	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	761	Open in IMG/M
3300031513\|Ga0308412_1134137	All Organisms → cellular organisms → Bacteria → Terrabacteria group	708	Open in IMG/M
3300031513\|Ga0308412_1176789	All Organisms → cellular organisms → Bacteria	587	Open in IMG/M
3300031513\|Ga0308412_1205497	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	530	Open in IMG/M
3300031514\|Ga0308390_1016299	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	2655	Open in IMG/M
3300031516\|Ga0308398_1057209	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	941	Open in IMG/M
3300031517\|Ga0308392_1001730	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	8643	Open in IMG/M
3300031767\|Ga0308401_1074069	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	666	Open in IMG/M
3300031776\|Ga0308415_1015173	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	2369	Open in IMG/M
3300031776\|Ga0308415_1082104	Not Available	681	Open in IMG/M
3300031776\|Ga0308415_1095672	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	605	Open in IMG/M
3300031783\|Ga0308418_1045513	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	1097	Open in IMG/M
3300031812\|Ga0308411_10019353	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	3822	Open in IMG/M
3300031865\|Ga0308408_1068165	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	831	Open in IMG/M
3300031948\|Ga0308406_1031216	All Organisms → cellular organisms → Bacteria	1295	Open in IMG/M
3300031948\|Ga0308406_1083578	All Organisms → cellular organisms → Bacteria	665	Open in IMG/M
3300031950\|Ga0308417_1112459	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	949	Open in IMG/M
3300031950\|Ga0308417_1197697	Not Available	630	Open in IMG/M
3300031966\|Ga0308420_1071902	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1181	Open in IMG/M
3300031966\|Ga0308420_1228381	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	521	Open in IMG/M
3300032033\|Ga0308402_1042260	Not Available	923	Open in IMG/M
3300032034\|Ga0308407_1055377	All Organisms → cellular organisms → Bacteria	886	Open in IMG/M
3300032034\|Ga0308407_1112488	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	546	Open in IMG/M
3300032045\|Ga0308400_1098559	All Organisms → cellular organisms → Bacteria	595	Open in IMG/M
3300032049\|Ga0308416_1030371	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium	1223	Open in IMG/M
3300032056\|Ga0308310_1092699	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	734	Open in IMG/M
3300032057\|Ga0308421_1117102	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	625	Open in IMG/M
3300032058\|Ga0308419_1097697	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	849	Open in IMG/M
3300032058\|Ga0308419_1101085	Not Available	826	Open in IMG/M
3300032356\|Ga0308414_1198980	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Chloroflexia → Chloroflexales → Roseiflexineae → Roseiflexaceae → Roseiflexus → unclassified Roseiflexus → Roseiflexus sp. RS-1	580	Open in IMG/M
3300033886\|Ga0308413_025638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1962	Open in IMG/M
3300034647\|Ga0372968_008638	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1670	Open in IMG/M
3300034649\|Ga0372972_009594	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1779	Open in IMG/M
3300034649\|Ga0372972_013749	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1391	Open in IMG/M
3300034649\|Ga0372972_020181	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1061	Open in IMG/M
3300034650\|Ga0372973_009574	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi	1935	Open in IMG/M

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Environmental	Environmental	100.00%

Habitat	Taxonomy	Distribution
Aquatic	Environmental → Aquatic	100.00%

Habitat	Taxonomy	Distribution
Thermal Springs	Environmental → Aquatic → Thermal Springs	100.00%

Habitat	Taxonomy	Distribution
Hot (42-90C)	Environmental → Aquatic → Thermal Springs → Hot (42-90C)	100.00%

Habitat	Taxonomy	Distribution
Unclassified	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified	98.02%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment	1.98%

Habitat	Taxonomy	Distribution
Hot Spring Phototrophic Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring Phototrophic Mat	51.49%
Anoxygenic And Chlorotrophic Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic Microbial Mat	41.58%
Anoxygenic And Chlorotrophic	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Anoxygenic And Chlorotrophic	4.95%
Sediment	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Sediment	0.99%
Microbial Mat	Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Microbial Mat	0.99%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002493	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS undermat 2012	Environmental	Open in IMG/M
3300005240	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005241	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0800_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005242	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005243	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005245	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0600_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005247	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2000_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005250	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1800_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005251	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005411	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005413	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500_T MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005452	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG	Environmental	Open in IMG/M
3300005453	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG	Environmental	Open in IMG/M
3300005490	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005494	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005495	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1400(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005499	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300005638	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006380	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1200_B MetaT (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300006848	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300006849	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300007000	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1700(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010176	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0300_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010179	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0900_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010181	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010183	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_0700_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010186	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010191	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1900_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010193	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1300(2)_T MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010246	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_2300_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010251	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1600(2)_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300010256	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS_1500(2)_B MetaT (Metagenome Metatranscriptome) (version 2)	Environmental	Open in IMG/M
3300020153	Sediment microbial communities from Great Boiling Springs, Gerlach, Nevada, United States - GBS 60_MetaG	Environmental	Open in IMG/M
3300026237	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP Bryant MS upper layer 2012 (SPAdes)	Environmental	Open in IMG/M
3300026509	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-T MetaG (SPAdes)	Environmental	Open in IMG/M
3300027279	Anoxygenic and chlorotrophic microbial mat microbial communities from Yellowstone National Park, USA - YNP MS-B MetaG (SPAdes)	Environmental	Open in IMG/M
3300028761	Hot spring microbial mat communities from Yellowstone National Park, WY, United States - YNP-CB-013-3	Environmental	Open in IMG/M
3300031245	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050930_P4	Environmental	Open in IMG/M
3300031508	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_me2	Environmental	Open in IMG/M
3300031509	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-60	Environmental	Open in IMG/M
3300031512	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T8	Environmental	Open in IMG/M
3300031513	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST1-BottomLayer	Environmental	Open in IMG/M
3300031514	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20040719_149	Environmental	Open in IMG/M
3300031516	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20051001_T9	Environmental	Open in IMG/M
3300031517	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20050624_m2	Environmental	Open in IMG/M
3300031767	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M1	Environmental	Open in IMG/M
3300031776	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS55	Environmental	Open in IMG/M
3300031783	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090729_R4cd	Environmental	Open in IMG/M
3300031812	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20070728_OST2-BottomLayer	Environmental	Open in IMG/M
3300031865	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060912_MSe3	Environmental	Open in IMG/M
3300031948	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe1	Environmental	Open in IMG/M
3300031950	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS65	Environmental	Open in IMG/M
3300031966	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS55	Environmental	Open in IMG/M
3300032033	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060913_OS-M2	Environmental	Open in IMG/M
3300032034	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20060911_MSe2	Environmental	Open in IMG/M
3300032045	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20060914_OS12-65	Environmental	Open in IMG/M
3300032049	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS60	Environmental	Open in IMG/M
3300032056	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS65	Environmental	Open in IMG/M
3300032057	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS60	Environmental	Open in IMG/M
3300032058	Hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20090730_MS50	Environmental	Open in IMG/M
3300032356	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090730_OS50	Environmental	Open in IMG/M
3300033886	Hot spring phototrophic mat microbial communities from Octopus Spring, Yellowstone National Park, Wyoming, United States - 20090729_t10cd	Environmental	Open in IMG/M
3300034647	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_0600_MSt7 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034649	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1400_MSt11 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M
3300034650	Metatranscriptome of hot spring phototrophic mat microbial communities from Mushroom Spring, Yellowstone National Park, Wyoming, United States - 20050701_1600_MSt12 (Metagenome Metatranscriptome)	Environmental	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24185J35167_10349191	3300002493	Anoxygenic And Chlorotrophic Microbial Mat	VSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEF*
Ga0068641_1294982	3300005240	Anoxygenic And Chlorotrophic Microbial Mat	VSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA*
Ga0068642_1107731	3300005241	Anoxygenic And Chlorotrophic Microbial Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD*
Ga0068639_1181771	3300005242	Anoxygenic And Chlorotrophic Microbial Mat	ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA*
Ga0068643_10063681	3300005243	Anoxygenic And Chlorotrophic Microbial Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA*
Ga0068643_10149181	3300005243	Anoxygenic And Chlorotrophic Microbial Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD*
Ga0068640_1102681	3300005245	Anoxygenic And Chlorotrophic Microbial Mat	SSDFLQRTHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA*
Ga0068640_1335742	3300005245	Anoxygenic And Chlorotrophic Microbial Mat	SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA*
Ga0068637_10151663	3300005247	Anoxygenic And Chlorotrophic Microbial Mat	HDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA*
Ga0068637_10153482	3300005247	Anoxygenic And Chlorotrophic Microbial Mat	SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEPGRPDA*
Ga0068635_10683603	3300005250	Anoxygenic And Chlorotrophic Microbial Mat	SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA*
Ga0068634_10619622	3300005251	Anoxygenic And Chlorotrophic Microbial Mat	HDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS*
Ga0068647_10272912	3300005411	Anoxygenic And Chlorotrophic Microbial Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD*
Ga0068633_10472242	3300005413	Anoxygenic And Chlorotrophic Microbial Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD*
Ga0068706_10966472	3300005452	Anoxygenic And Chlorotrophic	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRSDG*
Ga0068705_100905301	3300005453	Anoxygenic And Chlorotrophic	LRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA*
Ga0068662_1057711	3300005490	Anoxygenic And Chlorotrophic Microbial Mat	HDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD*
Ga0068668_10091871	3300005494	Anoxygenic And Chlorotrophic Microbial Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA*
Ga0068668_10217581	3300005494	Anoxygenic And Chlorotrophic Microbial Mat	ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA*
Ga0068666_10124672	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	DHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDA*
Ga0068666_10251143	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD*
Ga0068666_10268073	3300005495	Anoxygenic And Chlorotrophic Microbial Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEPGRPDA*
Ga0068667_10277042	3300005499	Anoxygenic And Chlorotrophic Microbial Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA*
Ga0068667_10429141	3300005499	Anoxygenic And Chlorotrophic Microbial Mat	ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGGVRRPDG*
Ga0068669_10739211	3300005638	Anoxygenic And Chlorotrophic Microbial Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA*
Ga0068664_11195591	3300006380	Anoxygenic And Chlorotrophic Microbial Mat	HDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDA*
Ga0101768_10236642	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	SARAFGGTETVDNLPANPPPFNPQGEKGDFGRPDA*
Ga0101768_10573701	3300006848	Anoxygenic And Chlorotrophic Microbial Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA*
Ga0102029_12238463	3300006849	Anoxygenic And Chlorotrophic Microbial Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA*
Ga0102029_12292931	3300006849	Anoxygenic And Chlorotrophic Microbial Mat	RQLAIKDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA*
Ga0102499_11474041	3300007000	Anoxygenic And Chlorotrophic Microbial Mat	DHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA*
Ga0124933_1557201	3300010176	Anoxygenic And Chlorotrophic Microbial Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGCPDD*
Ga0124936_10966541	3300010179	Anoxygenic And Chlorotrophic Microbial Mat	ARAFGGTETVDNLPANPPPFNPHGEKGEFGCPDA*
Ga0124926_10781313	3300010181	Anoxygenic And Chlorotrophic Microbial Mat	DHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDGWNER*
Ga0124919_11436181	3300010183	Anoxygenic And Chlorotrophic Microbial Mat	SARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS*
Ga0124916_10156691	3300010186	Anoxygenic And Chlorotrophic Microbial Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDGWNER*
Ga0124914_11970491	3300010191	Anoxygenic And Chlorotrophic Microbial Mat	SARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA*
Ga0124924_11142082	3300010193	Anoxygenic And Chlorotrophic Microbial Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGRPDG*
Ga0124932_1059121	3300010246	Anoxygenic And Chlorotrophic Microbial Mat	ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD*
Ga0124940_10619871	3300010251	Anoxygenic And Chlorotrophic Microbial Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA*
Ga0124939_11872972	3300010256	Anoxygenic And Chlorotrophic Microbial Mat	ARAFGGTETVDNLPANPPPFNPVWEKGEFGRPDG*
Ga0197142_10379601	3300020153	Sediment	HDHDTDGSARAFGGTETVDNLPASPPPFNPQGEKGELGRPDV
Ga0209750_10385361	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	ILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA
Ga0209750_10709742	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDA
Ga0209750_10716311	3300026237	Anoxygenic And Chlorotrophic Microbial Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA
Ga0209809_10316182	3300026509	Anoxygenic And Chlorotrophic	RAGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS
Ga0209691_10109073	3300027279	Anoxygenic And Chlorotrophic	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS
Ga0209691_10672772	3300027279	Anoxygenic And Chlorotrophic	TILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEQGESGRPDA
Ga0272447_10637811	3300028761	Microbial Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRADG
Ga0308395_10103483	3300031245	Hot Spring Phototrophic Mat	GHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNHTGEKGESGRSDG
Ga0308395_10563261	3300031245	Hot Spring Phototrophic Mat	DGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA
Ga0308395_10876931	3300031245	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDD
Ga0308395_11004532	3300031245	Hot Spring Phototrophic Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGAFGRADG
Ga0308394_10799832	3300031508	Hot Spring Phototrophic Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFKEKGEVGRPDG
Ga0308394_10839401	3300031508	Hot Spring Phototrophic Mat	DGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDA
Ga0308394_10886231	3300031508	Hot Spring Phototrophic Mat	DTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFERPDA
Ga0308394_10899472	3300031508	Hot Spring Phototrophic Mat	LRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA
Ga0308399_10235551	3300031509	Hot Spring Phototrophic Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGESGRPDA
Ga0308399_10812361	3300031509	Hot Spring Phototrophic Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFERPDA
Ga0308397_10318841	3300031512	Hot Spring Phototrophic Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGHPDS
Ga0308397_10653182	3300031512	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPES
Ga0308397_10931762	3300031512	Hot Spring Phototrophic Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNLHGEKGVSGRPDAWKGR
Ga0308397_11005981	3300031512	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGDLGRSDA
Ga0308397_11262081	3300031512	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG
Ga0308412_11117282	3300031513	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDA
Ga0308412_11210151	3300031513	Hot Spring Phototrophic Mat	HDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGRPDG
Ga0308412_11341371	3300031513	Hot Spring Phototrophic Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNSHGEKGEFGRPDT
Ga0308412_11767891	3300031513	Hot Spring Phototrophic Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD
Ga0308412_12054972	3300031513	Hot Spring Phototrophic Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPDA
Ga0308390_10162993	3300031514	Hot Spring Phototrophic Mat	AGHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNHTGEKGESGRSDG
Ga0308398_10572092	3300031516	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEPGRPDA
Ga0308392_10017301	3300031517	Hot Spring Phototrophic Mat	VSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDT
Ga0308401_10740692	3300031767	Hot Spring Phototrophic Mat	DHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG
Ga0308415_10151732	3300031776	Hot Spring Phototrophic Mat	SFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPHT
Ga0308415_10821041	3300031776	Hot Spring Phototrophic Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGEFGRPDG
Ga0308415_10956721	3300031776	Hot Spring Phototrophic Mat	GHTILRVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPDA
Ga0308418_10455131	3300031783	Hot Spring Phototrophic Mat	SRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGECGRPDA
Ga0308411_100193531	3300031812	Hot Spring Phototrophic Mat	DHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEFGRPDGWNER
Ga0308408_10681651	3300031865	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGESGRPDA
Ga0308406_10312161	3300031948	Hot Spring Phototrophic Mat	DGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDG
Ga0308406_10835781	3300031948	Hot Spring Phototrophic Mat	TDGSARAFGGTETVDNLPANPPPFNLHGEKGVSGRPDAWKGR
Ga0308417_11124591	3300031950	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPLWEKGESGRPDG
Ga0308417_11976971	3300031950	Hot Spring Phototrophic Mat	SARAFGGTETVDNLPANPPPFNPHGEKGEFERPDA
Ga0308420_10719021	3300031966	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA
Ga0308420_12283811	3300031966	Hot Spring Phototrophic Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG
Ga0308402_10422601	3300032033	Hot Spring Phototrophic Mat	GSARAFGGTETVDNLPANPPPFNPQGEKGELGRPDA
Ga0308407_10553772	3300032034	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGESGRPDA
Ga0308407_11124881	3300032034	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGEVGRPDG
Ga0308400_10985591	3300032045	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGECGCPDD
Ga0308416_10303711	3300032049	Hot Spring Phototrophic Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDT
Ga0308310_10926992	3300032056	Hot Spring Phototrophic Mat	HDTDGSARAFGGTETVDNLPANPPPFNPQGEKGESGRPDA
Ga0308421_11171022	3300032057	Hot Spring Phototrophic Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA
Ga0308419_10976972	3300032058	Hot Spring Phototrophic Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGERGEFGRPDD
Ga0308419_11010851	3300032058	Hot Spring Phototrophic Mat	DTDGSARAFGGTETVDNLPANPPPFNPHGEKGVFGRPDA
Ga0308414_11989801	3300032356	Hot Spring Phototrophic Mat	RVSRSFHDHDTDGSARAFGGTETVDNLPANPPPFNPHGEKGVSGRPDA
Ga0308413_025638_1_132	3300033886	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGHPDG
Ga0372968_008638_3_134	3300034647	Hot Spring Phototrophic Mat	FHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRADG
Ga0372972_009594_1_117	3300034649	Hot Spring Phototrophic Mat	TDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRPDG
Ga0372972_013749_1255_1389	3300034649	Hot Spring Phototrophic Mat	SFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGCPDA
Ga0372972_020181_1_138	3300034649	Hot Spring Phototrophic Mat	RSFHDHDTDGSARAFGGTETVDNLPANPPPFNPQGEKGEFGRSDG
Ga0372973_009574_3_125	3300034650	Hot Spring Phototrophic Mat	HDTDGSARAFGGTETVDNLPANPPPFNPHGEKGAFGRPDA

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

Metagenome / Metatranscriptome Family F103323

Overview

Multiple Sequence Alignments

Structure & Topology

Predicted Secondary Structure and Topology

Gene Neighborhood

Neighboring Pfam domains

Neighboring Clusters of Orthologous Genes (COGs)

Phylogeny

NCBI Taxonomy

Associated Scaffolds

Environmental Properties

Associated Habitat Types

Associated Samples

Family Sequences