Basic Information | |
---|---|
Family ID | F103538 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 45 residues |
Representative Sequence | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVL |
Number of Associated Samples | 92 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 97.80 % |
% of genes near scaffold ends (potentially truncated) | 86.14 % |
% of genes from short scaffolds (< 2000 bps) | 76.24 % |
Associated GOLD sequencing projects | 85 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.66 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (52.475 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (9.901 % of family members) |
Environment Ontology (ENVO) | Unclassified (31.683 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (43.564 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 57.53% β-sheet: 0.00% Coil/Unstructured: 42.47% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.66 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF06718 | DUF1203 | 5.94 |
PF05199 | GMC_oxred_C | 2.97 |
PF13185 | GAF_2 | 2.97 |
PF04392 | ABC_sub_bind | 1.98 |
PF10009 | DUF2252 | 1.98 |
PF01790 | LGT | 0.99 |
PF00106 | adh_short | 0.99 |
PF12071 | DUF3551 | 0.99 |
PF07786 | HGSNAT_cat | 0.99 |
PF01209 | Ubie_methyltran | 0.99 |
PF02771 | Acyl-CoA_dh_N | 0.99 |
PF00486 | Trans_reg_C | 0.99 |
PF02371 | Transposase_20 | 0.99 |
PF09361 | Phasin_2 | 0.99 |
PF13414 | TPR_11 | 0.99 |
PF00313 | CSD | 0.99 |
PF04828 | GFA | 0.99 |
PF00691 | OmpA | 0.99 |
PF16980 | CitMHS_2 | 0.99 |
PF00690 | Cation_ATPase_N | 0.99 |
PF02518 | HATPase_c | 0.99 |
PF13531 | SBP_bac_11 | 0.99 |
PF07883 | Cupin_2 | 0.99 |
PF13193 | AMP-binding_C | 0.99 |
PF13343 | SBP_bac_6 | 0.99 |
PF03625 | DUF302 | 0.99 |
COG ID | Name | Functional Category | % Frequency in 101 Family Scaffolds |
---|---|---|---|
COG2303 | Choline dehydrogenase or related flavoprotein | Lipid transport and metabolism [I] | 2.97 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 1.98 |
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 0.99 |
COG3791 | Uncharacterized conserved protein | Function unknown [S] | 0.99 |
COG0474 | Magnesium-transporting ATPase (P-type) | Inorganic ion transport and metabolism [P] | 0.99 |
COG0682 | Prolipoprotein diacylglyceryltransferase | Cell wall/membrane/envelope biogenesis [M] | 0.99 |
COG1960 | Acyl-CoA dehydrogenase related to the alkylation response protein AidB | Lipid transport and metabolism [I] | 0.99 |
COG2226 | Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG | Coenzyme transport and metabolism [H] | 0.99 |
COG2227 | 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase | Coenzyme transport and metabolism [H] | 0.99 |
COG3439 | Uncharacterized conserved protein, DUF302 family | Function unknown [S] | 0.99 |
COG3503 | Uncharacterized membrane protein, DUF1624 family | Function unknown [S] | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 52.48 % |
All Organisms | root | All Organisms | 47.52 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000364|INPhiseqgaiiFebDRAFT_100627226 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2650 | Open in IMG/M |
3300000364|INPhiseqgaiiFebDRAFT_105890940 | Not Available | 1372 | Open in IMG/M |
3300000734|JGI12535J11911_1020233 | Not Available | 524 | Open in IMG/M |
3300000816|AF_2010_repII_A10DRAFT_1032467 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 551 | Open in IMG/M |
3300000955|JGI1027J12803_100174843 | All Organisms → cellular organisms → Bacteria | 2176 | Open in IMG/M |
3300004114|Ga0062593_100646081 | All Organisms → cellular organisms → Bacteria | 1020 | Open in IMG/M |
3300005169|Ga0066810_10146235 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
3300005171|Ga0066677_10732079 | Not Available | 551 | Open in IMG/M |
3300005337|Ga0070682_101454790 | Not Available | 588 | Open in IMG/M |
3300005338|Ga0068868_101500866 | Not Available | 631 | Open in IMG/M |
3300005344|Ga0070661_100000590 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 27434 | Open in IMG/M |
3300005439|Ga0070711_101727465 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 548 | Open in IMG/M |
3300005455|Ga0070663_100055870 | Not Available | 2827 | Open in IMG/M |
3300005548|Ga0070665_100465317 | Not Available | 1275 | Open in IMG/M |
3300005578|Ga0068854_101296767 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 655 | Open in IMG/M |
3300005719|Ga0068861_100644863 | Not Available | 978 | Open in IMG/M |
3300005764|Ga0066903_108857216 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 510 | Open in IMG/M |
3300005842|Ga0068858_101830000 | Not Available | 600 | Open in IMG/M |
3300006057|Ga0075026_100241272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 966 | Open in IMG/M |
3300006581|Ga0074048_12189824 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 561 | Open in IMG/M |
3300006806|Ga0079220_11893808 | Not Available | 528 | Open in IMG/M |
3300006854|Ga0075425_100516750 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1375 | Open in IMG/M |
3300006954|Ga0079219_10107877 | Not Available | 1386 | Open in IMG/M |
3300007076|Ga0075435_101948801 | Not Available | 516 | Open in IMG/M |
3300009011|Ga0105251_10642176 | Not Available | 507 | Open in IMG/M |
3300009162|Ga0075423_10128342 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2661 | Open in IMG/M |
3300009174|Ga0105241_10523379 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Agrobacterium | 1061 | Open in IMG/M |
3300009174|Ga0105241_11979990 | Not Available | 573 | Open in IMG/M |
3300010047|Ga0126382_10882437 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium japonicum → Bradyrhizobium japonicum SEMIA 5079 | 772 | Open in IMG/M |
3300010358|Ga0126370_10684951 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 898 | Open in IMG/M |
3300010359|Ga0126376_11282596 | Not Available | 752 | Open in IMG/M |
3300010371|Ga0134125_10138863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2706 | Open in IMG/M |
3300011009|Ga0129318_10346757 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 518 | Open in IMG/M |
3300012477|Ga0157336_1023365 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 575 | Open in IMG/M |
3300012884|Ga0157300_1074956 | All Organisms → cellular organisms → Bacteria | 581 | Open in IMG/M |
3300012914|Ga0157297_10159622 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 744 | Open in IMG/M |
3300012948|Ga0126375_10205847 | All Organisms → cellular organisms → Bacteria | 1296 | Open in IMG/M |
3300012957|Ga0164303_10943821 | Not Available | 608 | Open in IMG/M |
3300012957|Ga0164303_11417506 | Not Available | 520 | Open in IMG/M |
3300012958|Ga0164299_10705445 | Not Available | 706 | Open in IMG/M |
3300012961|Ga0164302_10965770 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 660 | Open in IMG/M |
3300012984|Ga0164309_11687409 | Not Available | 543 | Open in IMG/M |
3300012987|Ga0164307_11047189 | Not Available | 667 | Open in IMG/M |
3300013306|Ga0163162_11513959 | Not Available | 764 | Open in IMG/M |
3300013306|Ga0163162_12726324 | Not Available | 569 | Open in IMG/M |
3300013308|Ga0157375_10637790 | Not Available | 1222 | Open in IMG/M |
3300014968|Ga0157379_12232835 | Not Available | 544 | Open in IMG/M |
3300015371|Ga0132258_11274526 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys | 1858 | Open in IMG/M |
3300015371|Ga0132258_11914037 | All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium | 1493 | Open in IMG/M |
3300015373|Ga0132257_104414203 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 512 | Open in IMG/M |
3300016270|Ga0182036_11254197 | All Organisms → cellular organisms → Bacteria | 617 | Open in IMG/M |
3300016294|Ga0182041_10769522 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 858 | Open in IMG/M |
3300017944|Ga0187786_10306762 | Not Available | 653 | Open in IMG/M |
3300017947|Ga0187785_10003631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 5041 | Open in IMG/M |
3300017959|Ga0187779_10466249 | Not Available | 832 | Open in IMG/M |
3300021478|Ga0210402_10973535 | Not Available | 775 | Open in IMG/M |
3300023071|Ga0247752_1013231 | All Organisms → cellular organisms → Bacteria | 1137 | Open in IMG/M |
3300023260|Ga0247798_1017572 | All Organisms → cellular organisms → Bacteria | 880 | Open in IMG/M |
3300025900|Ga0207710_10011817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3672 | Open in IMG/M |
3300025903|Ga0207680_10868965 | Not Available | 646 | Open in IMG/M |
3300025908|Ga0207643_10922590 | Not Available | 566 | Open in IMG/M |
3300025915|Ga0207693_10040103 | All Organisms → cellular organisms → Bacteria | 3687 | Open in IMG/M |
3300025917|Ga0207660_10822073 | Not Available | 758 | Open in IMG/M |
3300025920|Ga0207649_10010850 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 5008 | Open in IMG/M |
3300025920|Ga0207649_10054180 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. ARR65 | 2495 | Open in IMG/M |
3300025928|Ga0207700_10153027 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1908 | Open in IMG/M |
3300025931|Ga0207644_10189457 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1616 | Open in IMG/M |
3300025941|Ga0207711_10055403 | Not Available | 3404 | Open in IMG/M |
3300025945|Ga0207679_11676190 | Not Available | 582 | Open in IMG/M |
3300025981|Ga0207640_10876895 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 782 | Open in IMG/M |
3300026887|Ga0207805_1001672 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 2701 | Open in IMG/M |
3300027010|Ga0207839_1007021 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1376 | Open in IMG/M |
3300027465|Ga0207626_100871 | Not Available | 825 | Open in IMG/M |
3300027775|Ga0209177_10064048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1079 | Open in IMG/M |
3300027907|Ga0207428_10268650 | Not Available | 1268 | Open in IMG/M |
3300027910|Ga0209583_10151623 | Not Available | 948 | Open in IMG/M |
3300027915|Ga0209069_10089937 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1473 | Open in IMG/M |
3300027993|Ga0247749_1052080 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 504 | Open in IMG/M |
3300028379|Ga0268266_10354174 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1380 | Open in IMG/M |
3300028828|Ga0307312_11073687 | Not Available | 533 | Open in IMG/M |
3300031231|Ga0170824_122780908 | Not Available | 632 | Open in IMG/M |
3300031546|Ga0318538_10776592 | Not Available | 520 | Open in IMG/M |
3300031913|Ga0310891_10096554 | All Organisms → cellular organisms → Bacteria | 902 | Open in IMG/M |
3300032013|Ga0310906_10121393 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium manausense | 1475 | Open in IMG/M |
3300032174|Ga0307470_10891866 | Not Available | 698 | Open in IMG/M |
3300032174|Ga0307470_11945257 | Not Available | 501 | Open in IMG/M |
3300032179|Ga0310889_10334336 | Not Available | 739 | Open in IMG/M |
3300032179|Ga0310889_10469875 | Not Available | 634 | Open in IMG/M |
3300032180|Ga0307471_103259913 | Not Available | 575 | Open in IMG/M |
3300032261|Ga0306920_100152205 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3447 | Open in IMG/M |
3300033760|Ga0314870_006604 | All Organisms → cellular organisms → Bacteria | 857 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 9.90% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.93% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 4.95% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 4.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.96% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 3.96% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 2.97% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 2.97% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.97% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.97% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.97% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 2.97% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.97% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.97% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 1.98% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 1.98% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.98% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.98% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 0.99% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.99% |
Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 0.99% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 0.99% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere | 0.99% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 0.99% |
Populus Endosphere | Host-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000364 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000734 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 81 | Environmental | Open in IMG/M |
3300000816 | Forest soil microbial communities from Amazon forest - 2010 replicate II A10 | Environmental | Open in IMG/M |
3300000955 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
3300005171 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_126 | Environmental | Open in IMG/M |
3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Environmental | Open in IMG/M |
3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Host-Associated | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Host-Associated | Open in IMG/M |
3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Environmental | Open in IMG/M |
3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Host-Associated | Open in IMG/M |
3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Host-Associated | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
3300006057 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2012 | Environmental | Open in IMG/M |
3300006195 | Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Host-Associated | Open in IMG/M |
3300006581 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006954 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control | Environmental | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Host-Associated | Open in IMG/M |
3300009094 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300011009 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_0.1_0.8_DNA | Environmental | Open in IMG/M |
3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Host-Associated | Open in IMG/M |
3300012884 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 | Environmental | Open in IMG/M |
3300012899 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S058-202B-2 | Environmental | Open in IMG/M |
3300012914 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S028-104C-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012957 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MG | Environmental | Open in IMG/M |
3300012958 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MG | Environmental | Open in IMG/M |
3300012961 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_202_MG | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300016270 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300017944 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_10_20_MG | Environmental | Open in IMG/M |
3300017947 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0815_BV2_4_20_MG | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300023071 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5 | Environmental | Open in IMG/M |
3300023260 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S197-509C-6 | Environmental | Open in IMG/M |
3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026879 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 50 (SPAdes) | Environmental | Open in IMG/M |
3300026887 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 49 (SPAdes) | Environmental | Open in IMG/M |
3300026953 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 8 (SPAdes) | Environmental | Open in IMG/M |
3300027010 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 64 (SPAdes) | Environmental | Open in IMG/M |
3300027465 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-BECK03-A (SPAdes) | Environmental | Open in IMG/M |
3300027775 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027993 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S199-509C-5 | Environmental | Open in IMG/M |
3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300031231 | Coassembly Site 11 (all samples) - Champenoux / Amance forest | Environmental | Open in IMG/M |
3300031546 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23 | Environmental | Open in IMG/M |
3300031913 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D4 | Environmental | Open in IMG/M |
3300032013 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3 | Environmental | Open in IMG/M |
3300032174 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05 | Environmental | Open in IMG/M |
3300032179 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D2 | Environmental | Open in IMG/M |
3300032180 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515 | Environmental | Open in IMG/M |
3300032261 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2) | Environmental | Open in IMG/M |
3300033760 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_C | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
INPhiseqgaiiFebDRAFT_1006272264 | 3300000364 | Soil | MWIMVVYTLIVLVGETITVAIGLVLDRIFPARFH* |
INPhiseqgaiiFebDRAFT_1058909403 | 3300000364 | Soil | MWIMVIYVLIVAVCESIVVAIGLALDRIYPALSLTVSLSLFFAILWLAWILAV |
JGI12535J11911_10202331 | 3300000734 | Tropical Forest Soil | MWILVIYVSIVAISETVVALLGLTLDRIYPALSLPISLSLFFAVLWLAWIV |
AF_2010_repII_A10DRAFT_10324671 | 3300000816 | Forest Soil | MWIMVVYTLIVLVGETITVSIGLVLDRIFPAASLTVSLTLFFAILWL |
JGI1027J12803_1001748434 | 3300000955 | Soil | MWIMVVYTLIVLVGETITVAIGLALDRIFPARFH* |
Ga0062593_1006460812 | 3300004114 | Soil | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFA |
Ga0066810_101462351 | 3300005169 | Soil | MWIMVVYTLIVLVGETTTVAIGLVLDRIFPSVSLTVSLTLFFAILWLAWVLAVH |
Ga0066677_107320792 | 3300005171 | Soil | MWIMAVYVLIVIVSELIVVAIGLILDRIAPVASLPVCLSLF |
Ga0070682_1014547901 | 3300005337 | Corn Rhizosphere | MWILIVYVLIVVAGESVVVAIGLALDRISPLASLPVSLSLFF |
Ga0068868_1015008661 | 3300005338 | Miscanthus Rhizosphere | MWILIIYILIVVVGESAVVGIGLVLDRTFPLASLTVSLTLFFAVLAFGWP |
Ga0070661_10000059027 | 3300005344 | Corn Rhizosphere | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVL |
Ga0070711_1017274651 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIMVVYTLIVLVGETITVAIGLVLDRIFPAASLPVSLTLFFAILW |
Ga0070663_1000558701 | 3300005455 | Corn Rhizosphere | MVVYVLIVVVSELIVVGIGLALDRIAPIASLPVSLTLFFAVLWFGWLLAVRW |
Ga0070685_107202011 | 3300005466 | Switchgrass Rhizosphere | MLILILYLSIVVVGEFLVVVLGLTLDRAYPPISLPVSLSLFFAVLYFAWPF |
Ga0070665_1004653173 | 3300005548 | Switchgrass Rhizosphere | MWILIVYILIVAVGETIVVGIGLALDRIYPVASLTVSLTLFFAVLGLNGL* |
Ga0068854_1012967671 | 3300005578 | Corn Rhizosphere | MWIMVVYILIVLVGETITVAIGLVLDRIFPSASLTVSLTLFFAI |
Ga0068861_1006448631 | 3300005719 | Switchgrass Rhizosphere | MWILIVYVLIVVVGEAVVVGIGLALDRTFPLASLPVSLTLFFAVLAFGWP |
Ga0066903_1088572161 | 3300005764 | Tropical Forest Soil | MWIMVVYTLIVLIGETITIAIGLVLDRIFPAASLPVSLTLFFAILWL |
Ga0068851_111035181 | 3300005834 | Corn Rhizosphere | MLILILYLSIVVVGEFLVVVLGLTLDRAYPPISLPVSLSLFFAVLYFAWPFSV |
Ga0068863_1018056782 | 3300005841 | Switchgrass Rhizosphere | MLILILYLSIVVVGEFLVVVLGLTLDRAYPPISLPVSLSLFFAVLYFAWPFS |
Ga0068858_1018300001 | 3300005842 | Switchgrass Rhizosphere | MWILIVYVLIVVAGESVVVAIGLALDRISPLASLPVSLSLFFAVL |
Ga0075026_1002412722 | 3300006057 | Watersheds | MWILIIYILIVVVGESVVVGIGLALDRTFPLASLPVSLTLFFAVLAF |
Ga0075366_109540282 | 3300006195 | Populus Endosphere | MLILILYLAIVVVGEFLVVVLGLALDRTYPPMSLPVSLSLFFAVLYFAWPFSVRLTEPR |
Ga0074048_121898242 | 3300006581 | Soil | MWIMVVYILIVLVGETITVAIGLVLDRIFPSASLTVSLTL |
Ga0079220_118938081 | 3300006806 | Agricultural Soil | MWILIIYILIVVIGEAAVIAIGLALDRIYPIASLTVSLTLF |
Ga0075425_1005167503 | 3300006854 | Populus Rhizosphere | MWIMVVYTLIVLVGETITVAIGLVLDRIFPAASLPVS |
Ga0079219_101078771 | 3300006954 | Agricultural Soil | MGSLIVYVLIVVVGEAVVITLGLTLDRIYHLASLPVSLSLFFA |
Ga0075435_1019488011 | 3300007076 | Populus Rhizosphere | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVSLTLFFAV |
Ga0105251_106421761 | 3300009011 | Switchgrass Rhizosphere | MWILIVYVLIVVVGEAVVVGMGLTLDRTFAAASLPVS |
Ga0111539_105474401 | 3300009094 | Populus Rhizosphere | MLILILYLAIVVVGEFLVVVLGLTLDRTYPPVSLPVSLSLFFAVLYFAWPFSVRLTEP |
Ga0075423_101283421 | 3300009162 | Populus Rhizosphere | MWIMVVYVLIVLVSESAVVAIGLVLDRIYPAFSLTV |
Ga0105241_105233791 | 3300009174 | Corn Rhizosphere | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVSLTLFFVVLAFG |
Ga0105241_119799901 | 3300009174 | Corn Rhizosphere | MWILIIYVLIVVVGEAVVVGIGLALDRTFPLASLTVS |
Ga0126382_108824371 | 3300010047 | Tropical Forest Soil | MWILSVYVLIVVVAEAIVVAIGLILDRIYPALSLPVSLSL |
Ga0126370_106849511 | 3300010358 | Tropical Forest Soil | MWIMVVYTLIVLVGETITVSIGLVLDRIFPAASLTVS |
Ga0126376_112825961 | 3300010359 | Tropical Forest Soil | MWIMVVYVLIVVICETIVVALGLALDRFYPPASLPVSLSLFFAVLWLSW |
Ga0134125_101388633 | 3300010371 | Terrestrial Soil | MWIMVVYILIVLVGETITVAIGLVLDRIFPSASLTVSLTLFFAILWLAWVLAVRL |
Ga0129318_103467571 | 3300011009 | Freshwater To Marine Saline Gradient | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVSLTLFFV |
Ga0157336_10233651 | 3300012477 | Arabidopsis Rhizosphere | MWIMVVYILIVLVGETITVAIGLVLDRIFPSASLTVSLT |
Ga0157300_10749561 | 3300012884 | Soil | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVLAFGW |
Ga0157299_102270651 | 3300012899 | Soil | MLILILYLSIVVVGEFLVVVLGLTLDRAYPPISLPVSLSLFFAVLYFAWPFSVRLTEP |
Ga0157297_101596221 | 3300012914 | Soil | MGILIVYVLIVVVGEAIVIAIGLALDRIYPLASLPVS |
Ga0126375_102058474 | 3300012948 | Tropical Forest Soil | MWIMVVYVLIVAVSETIVVAIGLILDRIYPALSLPVSLSLFFAV |
Ga0164303_109438211 | 3300012957 | Soil | MWILIIYVLIVVVGEAVVVGIGLALDRTFPVASLTFSFT |
Ga0164303_114175062 | 3300012957 | Soil | MWILIIYILIVVVGEAIVIGIGLALDRIYPIASLTVSLTLFFAVLGFGWPLAVRW |
Ga0164299_107054451 | 3300012958 | Soil | MWIMVVYVLIVVVSELIVFGIGLALDRIAPIASLPVSLTMFFAVLWFGWLLAV |
Ga0164302_109657701 | 3300012961 | Soil | MWIMVVYTLIVLVGETITVAIGLVLDRIFPAASLPV |
Ga0164309_116874091 | 3300012984 | Soil | MWILIVYVLIVVAGESVVVAIGLALDRISPLASLP |
Ga0164307_110471891 | 3300012987 | Soil | MWILIVYVLIVVVGEAAVVATGLVLDRVLPLASLPVS |
Ga0163162_115139591 | 3300013306 | Switchgrass Rhizosphere | MWILIIYILIVVVGESVVVGIGLALDRTFPLASLPVSLTLFFAVLAFGWPL |
Ga0163162_127263241 | 3300013306 | Switchgrass Rhizosphere | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVS |
Ga0157375_106377904 | 3300013308 | Miscanthus Rhizosphere | MWILIIYVLIVVVGEAVVVGIGLALDRTFPLASLTVSL |
Ga0157379_122328351 | 3300014968 | Switchgrass Rhizosphere | MWILIIYILIVVVGESAVVGIGLVLDRTFPLASLTVSLTLFFAVLAFG |
Ga0132258_112745266 | 3300015371 | Arabidopsis Rhizosphere | MWILIVYILIVVMGESVVVATGLALDRIFPLASLPVSLTLFF |
Ga0132258_119140371 | 3300015371 | Arabidopsis Rhizosphere | MWILIVYVLIVVVGEAVVIAIGLTLDRIYPLASLPVSLSLFFAVLAFGWP |
Ga0132257_1044142032 | 3300015373 | Arabidopsis Rhizosphere | MWILIVYVLIVVIGEAVVVTIGLALDRIYPLASLPVSLSLFFAVLAFG |
Ga0182036_112541971 | 3300016270 | Soil | MWIMVVYVFIVAISELVVVAIGLVLDRIFPVASLPV |
Ga0182041_107695222 | 3300016294 | Soil | MWILMVYVLIVVIGEGIVISIGLTLDRIFPLASLPVSLTLFFAVLAFGWILA |
Ga0187786_103067621 | 3300017944 | Tropical Peatland | MWIMAIYVAIVLISESIVVGIGLALDRIYRVASLPVSLSLFFIV |
Ga0187785_100036315 | 3300017947 | Tropical Peatland | MWIMVVYILIVVVGETITVAIGLVLDRIFPSASLTVSLTLFFAILWLAWILA |
Ga0187779_104662492 | 3300017959 | Tropical Peatland | MWILVVYVLIVTISEVAVTAIGLVLDRIYPVLSLPVSLSLFFAVLG |
Ga0210402_109735351 | 3300021478 | Soil | MWIMVVYVLIVVVSELIVVGIGLALDRIAPIASLPVSLT |
Ga0247752_10132311 | 3300023071 | Soil | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVLAFGWPL |
Ga0247798_10175721 | 3300023260 | Soil | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVLAFGWPLA |
Ga0207710_100118174 | 3300025900 | Switchgrass Rhizosphere | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVLAFGWPLAV |
Ga0207680_108689652 | 3300025903 | Switchgrass Rhizosphere | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVSLT |
Ga0207643_109225902 | 3300025908 | Miscanthus Rhizosphere | MWILIVYVLIVVAGESVVVAIGLALDRISPLASLPVS |
Ga0207693_100401034 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MWIMVVYILIVVVSELIVVGIGLALDRIAPIASLPVSL |
Ga0207660_108220732 | 3300025917 | Corn Rhizosphere | MWIMVVYVLIVVVSELIVVGIGLALDRIAPIASLPV |
Ga0207649_100108501 | 3300025920 | Corn Rhizosphere | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPV |
Ga0207649_100541804 | 3300025920 | Corn Rhizosphere | MWIMVVYILIVLVGETITVAIGLVLDRIFPSASLTVSLTLFFAILWLAWVLAV |
Ga0207700_101530273 | 3300025928 | Corn, Switchgrass And Miscanthus Rhizosphere | MWILIVYVLIVVAGESVVVAIGLALDRISPLASLPVSL |
Ga0207644_101894571 | 3300025931 | Switchgrass Rhizosphere | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVSLTLFFGVLAFGW |
Ga0207711_100554031 | 3300025941 | Switchgrass Rhizosphere | MWILIVYVLIVVAGESVVVAIGLALDRISPLASLPVSLSLFFAVLAFGWP |
Ga0207679_116761901 | 3300025945 | Corn Rhizosphere | MWILIIYILIVVVGESVVVGIGLALDRTFPLASLPVSLTLFFAVLAFGWPLAVR |
Ga0207640_108768951 | 3300025981 | Corn Rhizosphere | MWIMVVYILIVLVGETITVAIGLVLDRIFPSASLTVSLTLFFAIL |
Ga0207641_114892342 | 3300026088 | Switchgrass Rhizosphere | MLILILYLSIVVVGEFLVVVLGLTLDRAYPPISLPVSLSLFFAVLYFAWPFSVR |
Ga0207763_10052283 | 3300026879 | Tropical Forest Soil | MWILVIYVSIVAISETVVALLGLTLDRIYPALSLPISLSLFFAVLWLAW |
Ga0207805_10016727 | 3300026887 | Tropical Forest Soil | MWILVIYVSIVTISETAVALLGLILDRIYPALSLPISLSLFFV |
Ga0207805_10041033 | 3300026887 | Tropical Forest Soil | MWILVIYVSIVAISETVVALLGLTLDRIYPALSLPISLSLFFAVLWLAWI |
Ga0207835_10320811 | 3300026953 | Tropical Forest Soil | MWILVIYVSIVAISETVVALLGLTLDRIYPALSLPISLSLFF |
Ga0207839_10070212 | 3300027010 | Tropical Forest Soil | MWILVIYVSIVAISETVVALLGLTLDRIYPALSLPISLSLFFAVLWLAWIVAVR |
Ga0207626_1008712 | 3300027465 | Soil | MWILIVYVLIVVVGEAVVVGIGLTLDRTFAAASLPVSLTLFFAVL |
Ga0209177_100640483 | 3300027775 | Agricultural Soil | MWIMVVYVAIVFVCESIVIAIGLALDRLYPPASLPISLSLFFAVLWLGWV |
Ga0207428_102686503 | 3300027907 | Populus Rhizosphere | MLILILYLAIVVVGEFLVVVLGLTLDRTYPPVSLPVSLSLFFAVLYFAWPFSVR |
Ga0209583_101516231 | 3300027910 | Watersheds | MWILIIYVLIVVIGEAVVVAIGLALDRMYPLASLPVSLSLFFAVLAFGWPLAVR |
Ga0209069_100899371 | 3300027915 | Watersheds | MWIMVVYVLIVAISELVVVAIGLALDRIYPLASLPVSLSLFFAVFW |
Ga0247749_10520801 | 3300027993 | Soil | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFF |
Ga0268266_103541741 | 3300028379 | Switchgrass Rhizosphere | MWILIVYILIVAVGETIVVGIGLALDRIYPVASLTVSLTLFFAVLGLNGL |
Ga0307312_110736871 | 3300028828 | Soil | MWILMFYILIVVIGESVVVAIGRVLDRIYPVLSLPVCLSLFFAVLAF |
Ga0170824_1227809081 | 3300031231 | Forest Soil | MWILTVYVLIVVVSESIVVAIGLVLDRIYPALSLPVSLSLFFA |
Ga0318538_107765921 | 3300031546 | Soil | MWIMVVYVFIVAISELVVVAIGLVLDRIFPVASLPVSLSLFFAVLW |
Ga0310891_100965541 | 3300031913 | Soil | MWILIIYVLIVVVGEAAVIAIGLALDRIYPLASLPVSLSLFFAVLAFGWP |
Ga0310906_101213931 | 3300032013 | Soil | MWILIVYVLIVVIGEAVVIAIGLALDRMYPLASLPVSLSLFFAVLAFGWPL |
Ga0307470_108918661 | 3300032174 | Hardwood Forest Soil | MWILIVYVLIVVVGEAIVVATGLALDRILPLASLPVSLSLFFAVLAFGWPLA |
Ga0307470_119452572 | 3300032174 | Hardwood Forest Soil | MWIMVVYVLIVVVSEMIVVGIGLAFDRIAPIASLPVSLTLFFAV |
Ga0310889_103343361 | 3300032179 | Soil | MWILIIYILIVVVGESVVVGIGLALDRTFPLASLP |
Ga0310889_104698751 | 3300032179 | Soil | MWILIVYVLIVVIGEAVVIAIGLALDRMYPLASLPVSLS |
Ga0307471_1032599132 | 3300032180 | Hardwood Forest Soil | MWILIVYVLIVVVGEAIVVATGLALDRILPLASLPVSLSLFFAVLAFGWPL |
Ga0306920_1001522051 | 3300032261 | Soil | MWIMAVYIVIVVVNELIVVAIGLALDHIAPAASLPVSLTLFFAVLW |
Ga0314870_006604_703_855 | 3300033760 | Peatland | MWIMVVYIAIVVVNELIVVGIGLALDRIAPLASLPVSLTLFFAVLWFGWLL |
⦗Top⦘ |