NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103742

Metagenome / Metatranscriptome Family F103742

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103742
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 45 residues
Representative Sequence MRTNSTTAITGAVLTTLLFAFSAFARDHSALNGTWTLVPAQSDFAG
Number of Associated Samples 84
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 82.18 %
% of genes near scaffold ends (potentially truncated) 97.03 %
% of genes from short scaffolds (< 2000 bps) 86.14 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (74.257 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog
(16.832 % of family members)
Environment Ontology (ENVO) Unclassified
(53.465 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(40.594 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.95%    β-sheet: 0.00%    Coil/Unstructured: 54.05%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF09335SNARE_assoc 5.94
PF00106adh_short 3.96
PF11154DUF2934 2.97
PF04366Ysc84 2.97
PF00582Usp 1.98
PF04055Radical_SAM 1.98
PF11138DUF2911 1.98
PF04972BON 1.98
PF09537DUF2383 1.98
PF13442Cytochrome_CBB3 1.98
PF00702Hydrolase 1.98
PF13649Methyltransf_25 0.99
PF00753Lactamase_B 0.99
PF02687FtsX 0.99
PF00882Zn_dep_PLPC 0.99
PF00474SSF 0.99
PF00689Cation_ATPase_C 0.99
PF01370Epimerase 0.99
PF01145Band_7 0.99
PF05239PRC 0.99
PF00155Aminotran_1_2 0.99
PF00174Oxidored_molyb 0.99
PF135322OG-FeII_Oxy_2 0.99
PF05050Methyltransf_21 0.99
PF11737DUF3300 0.99
PF03446NAD_binding_2 0.99
PF12543DUF3738 0.99
PF03169OPT 0.99
PF01258zf-dskA_traR 0.99
PF135632_5_RNA_ligase2 0.99
PF12681Glyoxalase_2 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG0398Uncharacterized membrane protein YdjX, related to fungal oxalate transporter, TVP38/TMEM64 familyFunction unknown [S] 5.94
COG0586Membrane integrity protein DedA, putative transporter, DedA/Tvp38 familyCell wall/membrane/envelope biogenesis [M] 5.94
COG1238Uncharacterized membrane protein YqaA, VTT domainFunction unknown [S] 5.94
COG2930Lipid-binding SYLF domain, Ysc84/FYVE familyLipid transport and metabolism [I] 2.97
COG0474Magnesium-transporting ATPase (P-type)Inorganic ion transport and metabolism [P] 0.99
COG1297Predicted oligopeptide transporter, OPT familyGeneral function prediction only [R] 0.99
COG1734RNA polymerase-binding transcription factor DksATranscription [K] 0.99
COG2041Molybdopterin-dependent catalytic subunit of periplasmic DMSO/TMAO and protein-methionine-sulfoxide reductasesEnergy production and conversion [C] 0.99
COG3915Uncharacterized conserved proteinFunction unknown [S] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms74.26 %
UnclassifiedrootN/A25.74 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001593|JGI12635J15846_10412615All Organisms → cellular organisms → Bacteria812Open in IMG/M
3300004092|Ga0062389_100806375All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1118Open in IMG/M
3300004092|Ga0062389_102623497All Organisms → cellular organisms → Bacteria → Acidobacteria670Open in IMG/M
3300004607|Ga0068948_1087085Not Available602Open in IMG/M
3300005436|Ga0070713_100046912All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae3548Open in IMG/M
3300005471|Ga0070698_102018631Not Available530Open in IMG/M
3300005536|Ga0070697_100787154Not Available841Open in IMG/M
3300005542|Ga0070732_10572122Not Available686Open in IMG/M
3300005546|Ga0070696_101527914All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300005591|Ga0070761_10263681All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae1031Open in IMG/M
3300005591|Ga0070761_10871774Not Available568Open in IMG/M
3300005591|Ga0070761_11100167All Organisms → cellular organisms → Bacteria506Open in IMG/M
3300005602|Ga0070762_10728346All Organisms → cellular organisms → Bacteria667Open in IMG/M
3300005616|Ga0068852_101588656All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus → Candidatus Solibacter usitatus Ellin6076676Open in IMG/M
3300005921|Ga0070766_10692791Not Available689Open in IMG/M
3300006052|Ga0075029_100326836Not Available984Open in IMG/M
3300006052|Ga0075029_101250251All Organisms → cellular organisms → Bacteria520Open in IMG/M
3300006102|Ga0075015_100662707All Organisms → cellular organisms → Bacteria616Open in IMG/M
3300006173|Ga0070716_101314585All Organisms → cellular organisms → Bacteria → Acidobacteria585Open in IMG/M
3300006176|Ga0070765_102176482Not Available517Open in IMG/M
3300006949|Ga0075528_10018055All Organisms → cellular organisms → Bacteria1742Open in IMG/M
3300009522|Ga0116218_1477654All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300009615|Ga0116103_1012463All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2852Open in IMG/M
3300009621|Ga0116116_1006376All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia5683Open in IMG/M
3300009628|Ga0116125_1241152Not Available523Open in IMG/M
3300009762|Ga0116130_1176810Not Available675Open in IMG/M
3300009824|Ga0116219_10719968All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300010379|Ga0136449_102174494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Pseudanabaenales → Prochlorotrichaceae → Halomicronema → Halomicronema hongdechloris → Halomicronema hongdechloris C2206810Open in IMG/M
3300010379|Ga0136449_103468491Not Available601Open in IMG/M
3300010379|Ga0136449_104381697Not Available521Open in IMG/M
3300010399|Ga0134127_11162655Not Available837Open in IMG/M
3300011269|Ga0137392_10545292Not Available963Open in IMG/M
3300014156|Ga0181518_10014206All Organisms → cellular organisms → Bacteria5838Open in IMG/M
3300014156|Ga0181518_10035914All Organisms → cellular organisms → Bacteria3135Open in IMG/M
3300014156|Ga0181518_10253764All Organisms → cellular organisms → Bacteria → Acidobacteria892Open in IMG/M
3300014156|Ga0181518_10413197All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6650Open in IMG/M
3300014158|Ga0181521_10503452Not Available579Open in IMG/M
3300014159|Ga0181530_10034083All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales3565Open in IMG/M
3300014159|Ga0181530_10221412All Organisms → cellular organisms → Bacteria1029Open in IMG/M
3300014160|Ga0181517_10611169All Organisms → cellular organisms → Bacteria545Open in IMG/M
3300014161|Ga0181529_10083533All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300014165|Ga0181523_10541259All Organisms → cellular organisms → Bacteria642Open in IMG/M
3300014199|Ga0181535_10063754All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Myxococcales → Cystobacterineae2478Open in IMG/M
3300014200|Ga0181526_10028926All Organisms → cellular organisms → Bacteria3588Open in IMG/M
3300014200|Ga0181526_10141268All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1543Open in IMG/M
3300014200|Ga0181526_10399936All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6872Open in IMG/M
3300014494|Ga0182017_10462693All Organisms → cellular organisms → Bacteria → Acidobacteria780Open in IMG/M
3300014496|Ga0182011_10381408All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300014499|Ga0182012_10943024All Organisms → cellular organisms → Bacteria543Open in IMG/M
3300014501|Ga0182024_12900387All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA4508Open in IMG/M
3300014502|Ga0182021_10424310All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1580Open in IMG/M
3300014638|Ga0181536_10526130Not Available512Open in IMG/M
3300014839|Ga0182027_10791631All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6993Open in IMG/M
3300014839|Ga0182027_11674087Not Available619Open in IMG/M
3300017938|Ga0187854_10071385All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61678Open in IMG/M
3300017940|Ga0187853_10038131All Organisms → cellular organisms → Bacteria2519Open in IMG/M
3300017946|Ga0187879_10289520All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3910Open in IMG/M
3300017955|Ga0187817_10702588Not Available645Open in IMG/M
3300017988|Ga0181520_10308622All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA61181Open in IMG/M
3300017988|Ga0181520_10729373All Organisms → cellular organisms → Bacteria674Open in IMG/M
3300018004|Ga0187865_1197891All Organisms → cellular organisms → Bacteria → Acidobacteria686Open in IMG/M
3300018009|Ga0187884_10169549All Organisms → cellular organisms → Bacteria912Open in IMG/M
3300018015|Ga0187866_1200753All Organisms → cellular organisms → Bacteria740Open in IMG/M
3300018024|Ga0187881_10397512Not Available565Open in IMG/M
3300018025|Ga0187885_10552393All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → unclassified Bryobacteraceae → Bryobacteraceae bacterium512Open in IMG/M
3300018026|Ga0187857_10130388All Organisms → cellular organisms → Bacteria1205Open in IMG/M
3300018033|Ga0187867_10061203All Organisms → cellular organisms → Bacteria2241Open in IMG/M
3300018033|Ga0187867_10556263All Organisms → cellular organisms → Bacteria629Open in IMG/M
3300018037|Ga0187883_10355952All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6749Open in IMG/M
3300018040|Ga0187862_10174102All Organisms → cellular organisms → Bacteria → Acidobacteria1433Open in IMG/M
3300018047|Ga0187859_10120681All Organisms → cellular organisms → Bacteria1382Open in IMG/M
3300018057|Ga0187858_10471237Not Available771Open in IMG/M
3300019082|Ga0187852_1160436All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA6948Open in IMG/M
3300019788|Ga0182028_1120905All Organisms → cellular organisms → Bacteria876Open in IMG/M
3300020004|Ga0193755_1075368All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus1086Open in IMG/M
3300020579|Ga0210407_10413454All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae1055Open in IMG/M
3300021178|Ga0210408_10581907All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → unclassified Candidatus Solibacter → Candidatus Solibacter sp.887Open in IMG/M
3300021420|Ga0210394_10436179Not Available1153Open in IMG/M
3300021432|Ga0210384_10421890Not Available1202Open in IMG/M
3300021477|Ga0210398_11075548Not Available639Open in IMG/M
3300021559|Ga0210409_11006189All Organisms → cellular organisms → Bacteria → Acidobacteria708Open in IMG/M
3300023068|Ga0224554_1085290All Organisms → cellular organisms → Bacteria749Open in IMG/M
3300025496|Ga0208191_1041833All Organisms → cellular organisms → Bacteria1016Open in IMG/M
3300025864|Ga0209429_10013161All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus4255Open in IMG/M
3300027986|Ga0209168_10141551All Organisms → cellular organisms → Bacteria → Acidobacteria1222Open in IMG/M
3300028577|Ga0265318_10395656Not Available505Open in IMG/M
3300030020|Ga0311344_11442792All Organisms → cellular organisms → Bacteria502Open in IMG/M
3300031057|Ga0170834_102314837All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300031235|Ga0265330_10169890All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Sulfopaludibacter → unclassified Candidatus Sulfopaludibacter → Candidatus Sulfopaludibacter sp. SbA3925Open in IMG/M
3300031235|Ga0265330_10222328Not Available797Open in IMG/M
3300031525|Ga0302326_11157793Not Available1069Open in IMG/M
3300031525|Ga0302326_11710326All Organisms → cellular organisms → Bacteria829Open in IMG/M
3300031962|Ga0307479_11992292All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae530Open in IMG/M
3300032160|Ga0311301_10661420All Organisms → cellular organisms → Bacteria → Acidobacteria1483Open in IMG/M
3300033402|Ga0326728_10546785All Organisms → cellular organisms → Bacteria922Open in IMG/M
3300033405|Ga0326727_10495302All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Bryobacteraceae → Bryobacter → Bryobacter aggregatus1066Open in IMG/M
3300033755|Ga0371489_0000537All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Bryobacterales → Solibacteraceae → Candidatus Solibacter → Candidatus Solibacter usitatus69802Open in IMG/M
3300033887|Ga0334790_068320All Organisms → cellular organisms → Bacteria1248Open in IMG/M
3300033888|Ga0334792_139078All Organisms → cellular organisms → Bacteria628Open in IMG/M
3300033982|Ga0371487_0063084All Organisms → cellular organisms → Bacteria2089Open in IMG/M
3300034091|Ga0326724_0103675All Organisms → cellular organisms → Bacteria → Acidobacteria1859Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog16.83%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland15.84%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil6.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.94%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen5.94%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil5.94%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland4.95%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere4.95%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil4.95%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds2.97%
SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Soil2.97%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere2.97%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.98%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil1.98%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.98%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.98%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.99%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil0.99%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
BogEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Bog0.99%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.99%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.99%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300004092Coassembly of ECP03_0M1, ECP03_OM2, ECP03_OM3, ECP04_OM1, ECP04_OM2, ECP04_OM3, ECP14_OM1, ECP14_OM2, ECP14_OM3EnvironmentalOpen in IMG/M
3300004607Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005536Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaGEnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005546Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaGEnvironmentalOpen in IMG/M
3300005591Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF1EnvironmentalOpen in IMG/M
3300005602Reference soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire, USA - Hubbard Brook CCASE Soil Metagenome REF2EnvironmentalOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300005921Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6EnvironmentalOpen in IMG/M
3300006052Freshwater sediment microbial communities from North America - Little Laurel Run_MetaG_LLR_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006949Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost159B-16BEnvironmentalOpen in IMG/M
3300009522Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_5_LS metaGEnvironmentalOpen in IMG/M
3300009615Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_100EnvironmentalOpen in IMG/M
3300009621Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_10_150EnvironmentalOpen in IMG/M
3300009628Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_16_10EnvironmentalOpen in IMG/M
3300009762Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_40EnvironmentalOpen in IMG/M
3300009824Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_6_BS metaGEnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010399Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300014156Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_60_metaGEnvironmentalOpen in IMG/M
3300014158Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_60_metaGEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014160Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin01_30_metaGEnvironmentalOpen in IMG/M
3300014161Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_30_metaGEnvironmentalOpen in IMG/M
3300014165Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin05_30_metaGEnvironmentalOpen in IMG/M
3300014199Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_30_metaGEnvironmentalOpen in IMG/M
3300014200Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaGEnvironmentalOpen in IMG/M
3300014494Permafrost microbial communities from Stordalen Mire, Sweden - 712E3D metaGEnvironmentalOpen in IMG/M
3300014496Permafrost microbial communities from Stordalen Mire, Sweden - 711E1D metaGEnvironmentalOpen in IMG/M
3300014499Permafrost microbial communities from Stordalen Mire, Sweden - 612S2S metaGEnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014502Permafrost microbial communities from Stordalen Mire, Sweden - 612E3M metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300014638Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_60_metaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300017938Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_150EnvironmentalOpen in IMG/M
3300017940Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_100EnvironmentalOpen in IMG/M
3300017946Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_10EnvironmentalOpen in IMG/M
3300017955Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2EnvironmentalOpen in IMG/M
3300017988Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaGEnvironmentalOpen in IMG/M
3300018004Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_100EnvironmentalOpen in IMG/M
3300018009Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_40EnvironmentalOpen in IMG/M
3300018015Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_150EnvironmentalOpen in IMG/M
3300018024Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_19_100EnvironmentalOpen in IMG/M
3300018025Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_100EnvironmentalOpen in IMG/M
3300018026Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_100EnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300018040Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_150EnvironmentalOpen in IMG/M
3300018047Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_10EnvironmentalOpen in IMG/M
3300018057Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_8_150EnvironmentalOpen in IMG/M
3300019082Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_6_40EnvironmentalOpen in IMG/M
3300019788Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (PacBio error correction)EnvironmentalOpen in IMG/M
3300020004Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H1a2EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021477Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-OEnvironmentalOpen in IMG/M
3300021559Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-17-MEnvironmentalOpen in IMG/M
3300023068Peat soil microbial communities from Stordalen Mire, Sweden - 717 S2 20-24EnvironmentalOpen in IMG/M
3300025496Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_13_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025864Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0004-212 (SPAdes)EnvironmentalOpen in IMG/M
3300027986Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen07_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028577Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaGHost-AssociatedOpen in IMG/M
3300030020II_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031235Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaGHost-AssociatedOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031962Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM4C_515EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300033402Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB31MNEnvironmentalOpen in IMG/M
3300033405Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB29MYEnvironmentalOpen in IMG/M
3300033755Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB26FY SIP fractionEnvironmentalOpen in IMG/M
3300033887Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-1-X1EnvironmentalOpen in IMG/M
3300033888Peat soil microbial communities from Stordalen Mire, Sweden - 713 P-3-X1EnvironmentalOpen in IMG/M
3300033982Lab enriched peat soil microbial communities from McLean, Ithaca, NY, United States - MB22AY SIP fractionEnvironmentalOpen in IMG/M
3300034091Peat soil microbial communities from McLean, Ithaca, NY, United States - MB00NEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI12635J15846_1041261523300001593Forest SoilMKTYSTTTIAGAVLTTLLFAFSAFARDHSALNGTWTLVP
Ga0062389_10080637513300004092Bog Forest SoilMKTCITTTAGAILTTLLFAIPAFGRDHSAMNGTWTLVPAKSEFSGQP
Ga0062389_10262349733300004092Bog Forest SoilMRTPSTMKITEAVFMTLLLTIPGFARDHRAMNGTWTMVPAKSNFAGQPV
Ga0068948_108708513300004607Peatlands SoilMRTHSTPRITGAVLTTLLFAYSASARDHSALNGTWTLLPAKSDFAGQP
Ga0070713_10004691243300005436Corn, Switchgrass And Miscanthus RhizosphereMRANSAITISGAVLTTVLLAFSAFAGDHSALNGVWTRVR*
Ga0070698_10201863113300005471Corn, Switchgrass And Miscanthus RhizosphereMSYRTSTITGAVLATLLFSFSAFADNRQVLNGTWTLVPAKSD
Ga0070697_10078715423300005536Corn, Switchgrass And Miscanthus RhizosphereMRTNSTSAITGAVLTTLLVTLSAFASNHSALNGTWTLVPAKSDFAGQPVVQTG
Ga0070732_1057212213300005542Surface SoilMRTYSATAIIGAVLTTLFFAFSAFAGDHSALNGTWTLVPAKSDFAGQP
Ga0070696_10152791423300005546Corn, Switchgrass And Miscanthus RhizosphereMRLYSTPRIAGAVWTTLLLASSVFAGDHRALNGTWTLVPAKS
Ga0070761_1026368113300005591SoilMKIYSTAVIAGAVLTTLFAFSAFAIDHRVLNGTWTLTPAKSDFA
Ga0070761_1087177423300005591SoilMTYDSTTTIARTVLTTLLFGFCAFAHEHTALNGTWTLVGGKSDFGGQPV
Ga0070761_1110016713300005591SoilMRTHSTVIIAGAALITLLLATPGFARDHTAMNGTWTMVPVKSDFAGQPVVQTGTVTIND
Ga0070762_1072834613300005602SoilMRISSITTIIGPVLTTLLFAAAASAHQHTALNGTWTLVPAQSD
Ga0068852_10158865623300005616Corn RhizosphereMRTHITVTGAVLATLLFAFSAFAWDHSSLNGTWTLVPASSDFAGQPVVQTGT
Ga0070766_1069279113300005921SoilMRPYSTTTTGAVLTTLLFAFSAFAHNHRALNGTWTL
Ga0075029_10032683643300006052WatershedsMRTHSTATVTGTVLTTLLFGFSAFGRGHSALNGTWTLVP
Ga0075029_10125025123300006052WatershedsMRNHSTITLSAVLLSTVLSASSAFARDHSALNGTWTLIPAKSDFAGQSV
Ga0075015_10066270723300006102WatershedsMRKYSTLRITGVALTTLLFAFPVFARDHGALNGTWILVPAKGDFAGQLVVQ
Ga0070716_10131458513300006173Corn, Switchgrass And Miscanthus RhizosphereMRTYFTTTIAGAVLTTLLFASTALARDHSALNGTW
Ga0070765_10217648213300006176SoilMRINSTTRISVAVLTTLLCAFSAFARDHSAFNGTWTLV
Ga0075528_1001805513300006949Arctic Peat SoilMRTNSTTIITGAVLTTLLCAFSAMARDHSTMNGTWTLVPTKSD
Ga0116218_147765423300009522Peatlands SoilMRTHSTATITGAVLTALLFAFSGFARDHHTALNGTW
Ga0116103_101246313300009615PeatlandMRTYSTTTITGAILTALLFAFSAVARDHSALNGTWTLVPAKSD
Ga0116116_100637663300009621PeatlandMRTYSTTTITGAILTALLFAFSAVARDHSALNGTWTLVPAKSDFAGQPVVQ
Ga0116125_124115223300009628PeatlandMRKYSITGAVLAIMLLAFSAFARGHTALNGTWTLVPTKSNFAGQPVVQTGTV
Ga0116130_117681013300009762PeatlandMRTYSTTAIAGAVLTTFLFAFSAYARDHSDLNGTWT
Ga0116219_1071996813300009824Peatlands SoilMRNYSTTAITGAVLATLLCTFFAFGRDHTALNGTWALVPAKSDF
Ga0136449_10217449413300010379Peatlands SoilMRTYSSTTIAGAVLATLLFALSAYARDHTALNGTWTMLPVKSDFAGQPVIQTGT
Ga0136449_10346849123300010379Peatlands SoilMKTYSTIAITGAVVSARGFGFSAFGRDHTALNGTWTLVPT
Ga0136449_10438169723300010379Peatlands SoilMRTYSATTITGAVLTTLFFAFSAFAHDHTALNGTWTLVPAKSDFAGQSVVQTGTVTI
Ga0134127_1116265513300010399Terrestrial SoilMRLYSTPRIAGAVWTTLLLASSVFAGDHRALNGTWTLVPAKSDF
Ga0137392_1054529223300011269Vadose Zone SoilVLWKEIMRIYSTTTITGAVLTTLLFAFSAFARDRTALNGTWTLVPADSDFSGQRVVQ
Ga0181518_10014206123300014156BogMRTYSAITITGAVLTTLLFAFSAFAHDHSALNGTWTLVP
Ga0181518_1003591413300014156BogMRKHSAVTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKS
Ga0181518_1025376413300014156BogMRKHSTTRITGAVLTTLLFAFSAFARDHRALNGTWTLVPAKSDFAGQP
Ga0181518_1041319723300014156BogMRKYSATTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKSDFAG
Ga0181521_1050345213300014158BogMRKYSATTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTK
Ga0181530_1003408353300014159BogMRTYSTITITGAVLTTLLFALPAFARDHTALNGTWTLVPAKSDFAGQPVVQTGTVT
Ga0181530_1022141233300014159BogMRTYSAITITGAVLTTLLFAFSAFAHDHSALNGTWTLVPTKSDFAGQ
Ga0181517_1061116913300014160BogMRTYSTTTIAGAVLTTLLFASSAVGRDHSALNGTWTLVPTKSDFAGQ
Ga0181529_1008353343300014161BogMRKHSAVTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKSDF
Ga0181523_1054125913300014165BogMKTYPIALAALTTLLLAFSAFARNHSALNGTWTLVPAKS
Ga0181535_1006375413300014199BogMQKYSTISITGAVLTTLLVAFSALARDRTALNGTWTLVPTQSDFAGQPV
Ga0181526_1002892613300014200BogMRKHSAVTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKSDFAG
Ga0181526_1014126833300014200BogMRTHSTTILGGAVFATLLFAFCAIARDHSALNGTWTLVPAKSDFAGQPVVQTGTVTI
Ga0181526_1039993613300014200BogMRKYSATTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKSDFA
Ga0182017_1046269323300014494FenMRTNSTTAITGAVLTTLLFAFSAFARDHSALNGTWTLVPAQSDFAG*
Ga0182011_1038140813300014496FenMRTFSTIKIAGAVLTAILFAFAAFAGDHRALNGTWTLVP
Ga0182012_1094302413300014499BogMRTYSTIIAGAVLTTLLFAFYAVARDHSALNGTWTLVPARSD
Ga0182024_1290038713300014501PermafrostMRTYSTTTITGVAFATLLCAFSAFARDHSALNGTWTLVPAKSDFAGQPVVQTG
Ga0182021_1042431033300014502FenMRKYSTTAITGAVLTTLLFAFSAFARDHSALNGTWTLVPAKSDFAGQSVVQTGTV
Ga0181536_1052613023300014638BogMPTRAFTTITGAGLAALLCAFSAFAHEHTALNGTWTLVPTQ
Ga0182027_1079163113300014839FenMRPYSATAITGAVFMTLLLAFSAFAHDHSALNGTWTLVPAKSDFA
Ga0182027_1167408713300014839FenMNRHSTITFVGAVLTTLLFAFGAFAHDRTALNGTWTMVPARSD
Ga0187854_1007138543300017938PeatlandMRTYSATTITGAALTTLLFAFSAFAHDHTALNGTWTLVPAKSDFA
Ga0187853_1003813163300017940PeatlandMRKHSAVTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKSDFAGQ
Ga0187879_1028952033300017946PeatlandMRKYSATTITGAVLTALLLAFAAFAHDRTALNGTWT
Ga0187817_1070258823300017955Freshwater SedimentMRTFSNTTIAGAVLTTLVFVVSAAFAHDHTALNGTWTLVPTK
Ga0181520_1030862213300017988BogMRTYSATAITGAVLTTLLFAFSAFAHDHTALSGTWTLVPARSDLAGQ
Ga0181520_1072937313300017988BogMKTYPIALAALTPLLLAFSAFARNHSALNGTWTLVPARSDLAGQSV
Ga0187865_119789113300018004PeatlandMRKYSTTRITGAVLTTLLFAFSAFARDHSALNGTWTL
Ga0187884_1016954913300018009PeatlandMRTHSTTTITGAVLTTLLFAFSAVARDHSALNGTWTLVPAKSDFAGQAVVQTGT
Ga0187866_120075313300018015PeatlandMRIYSTATITGAVLTTLLFAFSAFARDHSALNGTWTL
Ga0187881_1039751223300018024PeatlandMRTYSATTITGAVLTTLFLAFAALAHDHTALNGTWTLVPAKSDFA
Ga0187885_1055239313300018025PeatlandMRTYSTIAVTGAVLTTLLFALSAFARDHSALNGTWSLVPAKSDFAGQPVVQTGTVTI
Ga0187857_1013038813300018026PeatlandMKTYSTATITGAVLTTLLFALSAFARDHSALNGTWTLVPAKSDFAGQRVVQTGTVTI
Ga0187867_1006120343300018033PeatlandMRTHSTTTITGAVLTTLLFALSAFAHDHRALNGTWTLVPAK
Ga0187867_1055626323300018033PeatlandMKISSTTGFAGAVGITLLFAFSAVAHDRSILNGTW
Ga0187883_1035595213300018037PeatlandMRKYSATTITGAVLTTLLLAFAAFAHDHTALNGTWTLVPTKSDF
Ga0187862_1017410213300018040PeatlandMKISSTTGFAGAVGITLLFAFSAVAHDRSILNGTWTLVPAKSDFA
Ga0187859_1012068123300018047PeatlandMQKYSTISITGAVLTTVLFAFPAFARDRTALNGTW
Ga0187858_1047123713300018057PeatlandMRTYLTTTITRVVLTTLPFAFCAFGRDHSALNGTWALVPAKSDFAGQPVVQTGTVTI
Ga0187852_116043633300019082PeatlandMRTYSTTAIAGAVLTTFLFAFSAYARDHSDLNGTWTLVP
Ga0182028_112090533300019788FenMRTYSATAITGAVLTTLLFAFSAFAHDHTALNGTWTLVPARSDFAGQP
Ga0193755_107536833300020004SoilMTTTMTGAVLTTLLFALSSVAGDHSALNGTWTLIPAKSNFAGQPVVQT
Ga0210407_1041345413300020579SoilMRNYLTITASGAALVLLALSAFARDHNSLNGTWTLVPAKSEFAGQPVVQSGTVTIN
Ga0210408_1058190713300021178SoilMSTYSTTTITGAVLTTLLFAFTAFGRDHSALTGTWTLVPVKSDFAGQPVIQTGT
Ga0210394_1043617913300021420SoilMRTYSATTITEAALTTLLFAASAFAHGHIGLNGAWTLVP
Ga0210384_1042189033300021432SoilMKTNTTPGMAGAVLAALLFAFPAFARDHSAMNGEWTLVPARSDFAGQPVVQTG
Ga0210398_1107554813300021477SoilMRKQSTIAIAGAVLLTALFAFSAFARDHHTAMNGTWTLAPTKSDFAG
Ga0210409_1100618913300021559SoilMKTYFITTITGAVLTTLLFAGPALARDHSSLNGTWTMVPAKSDFAGQ
Ga0224554_108529023300023068SoilMQKYSTISITGAVFTTLLFAFSAFARDRTALNGTWTLVPTRSD
Ga0208191_104183313300025496PeatlandMKTYPIALAALTTLLLTFSAFARDHSALNGTWTLV
Ga0209429_1001316153300025864Arctic Peat SoilMRTNSTTIITGAVLTTLLFAFSAMARDHSTMNGTWTLVPT
Ga0209168_1014155113300027986Surface SoilMRTYSTTIAGVLTTILFASSALAHDHRALNGTWTLVPAKSDFAGQRVVQ
Ga0265318_1039565623300028577RhizosphereMGKYSIKVIAGVVLTTWLFVFPAFARDHSALNGTWTLLPAKSYFAGEPVVQTGT
Ga0311344_1144279223300030020BogMKTYPIALATLTTLLLAFSAFARDHSALNGTWTLVPAKSDF
Ga0170834_10231483723300031057Forest SoilMRIYSTTAISGAVLTTLLFAFSAFAREHSALNGTWTLVPAESDFA
Ga0265330_1016989013300031235RhizosphereMKIYSATTITGGVLTALLLALAAFAHDHKELNGTW
Ga0265330_1022232813300031235RhizosphereMRKHSTTAIAGAVLTVLLFALPASAREHNALNGTWTLIPAR
Ga0302326_1115779323300031525PalsaMRKQSIITIAGAVLASLLCAFSAIARDHSALNGTWTLIPAKSDFAG
Ga0302326_1171032633300031525PalsaMRINSTTTIAGAVLTAALFAFSAFAHEHTALNGTWTLVPANSDFAG
Ga0307479_1199229223300031962Hardwood Forest SoilMKTYTTITGAVLTTLLLALSAGARDHSSLNGTWTLVPAKSNFAGQPVV
Ga0311301_1066142013300032160Peatlands SoilMSTHSTTAITGAVLTTLLFAFTAFAREHSALNGTWTLVP
Ga0326728_1054678513300033402Peat SoilMKTYSTTRIAGAVWTALLFAFCAFASDHSALNGTWTLVPAR
Ga0326727_1049530233300033405Peat SoilMRISPCTAISACVLTALLVAFSAVAGGHNALNGTWTLVPTKSDFGGQ
Ga0371489_0000537_1_1173300033755Peat SoilMRTHSTTTITGAVLTTLLFAFSAVARDHSALNGTWTLVP
Ga0334790_068320_598_7533300033887SoilMKTYPIALAALTTLLLAFSAFARNHSALNGTWTLVPAKSDFAGQPSFKAAR
Ga0334792_139078_476_6283300033888SoilMRIYSGTTLTGVVLTALLCAFSALGRDHSALNGTWTLAPTKSDFRGEPVVQ
Ga0371487_0063084_1933_20883300033982Peat SoilMRTHSTTTITGAVLTTLLFAFSAVARDHSALNGTWTLVPAKSDFAGQAVVQT
Ga0326724_0103675_2_1153300034091Peat SoilMRTSSATAIGGVVLTTLLFAFSAIARDHSAMNGTWTLV

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.