NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F103803

Metagenome / Metatranscriptome Family F103803

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F103803
Family Type Metagenome / Metatranscriptome
Number of Sequences 101
Average Sequence Length 41 residues
Representative Sequence MANQVTQEKPKRGLSLDGWAVAIALLLAALVKLGALKHVGW
Number of Associated Samples 78
Number of Associated Scaffolds 101

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 90.10 %
% of genes near scaffold ends (potentially truncated) 14.85 %
% of genes from short scaffolds (< 2000 bps) 82.18 %
Associated GOLD sequencing projects 67
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (82.178 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(15.842 % of family members)
Environment Ontology (ENVO) Unclassified
(29.703 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(47.525 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: No Secondary Structure distribution: α-helix: 36.23%    β-sheet: 0.00%    Coil/Unstructured: 63.77%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 101 Family Scaffolds
PF03601Cons_hypoth698 61.39
PF14765PS-DH 3.96
PF13905Thioredoxin_8 1.98
PF00664ABC_membrane 0.99
PF13145Rotamase_2 0.99
PF01734Patatin 0.99
PF04185Phosphoesterase 0.99
PF02735Ku 0.99
PF13450NAD_binding_8 0.99
PF12833HTH_18 0.99
PF00702Hydrolase 0.99

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 101 Family Scaffolds
COG2855Uncharacterized membrane protein YadS, UPF0324 familyFunction unknown [S] 61.39
COG1273Non-homologous end joining protein Ku, dsDNA break repairReplication, recombination and repair [L] 0.99
COG1752Predicted acylesterase/phospholipase RssA, containd patatin domainGeneral function prediction only [R] 0.99
COG3511Phospholipase CCell wall/membrane/envelope biogenesis [M] 0.99
COG3621Patatin-like phospholipase/acyl hydrolase, includes sporulation protein CotRGeneral function prediction only [R] 0.99
COG4667Predicted phospholipase, patatin/cPLA2 familyLipid transport and metabolism [I] 0.99

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms82.18 %
UnclassifiedrootN/A17.82 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2170459010|GIO7OMY02GCWYZNot Available505Open in IMG/M
2199352024|deeps_contig36498.23180All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1242Open in IMG/M
3300002245|JGIcombinedJ26739_100327269Not Available1415Open in IMG/M
3300002568|C688J35102_120815073All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → unclassified Acidobacteriaceae → Acidobacteriaceae bacterium KBS 831668Open in IMG/M
3300003324|soilH2_10324145All Organisms → cellular organisms → Bacteria2081Open in IMG/M
3300004479|Ga0062595_100026215All Organisms → cellular organisms → Bacteria2312Open in IMG/M
3300004479|Ga0062595_100190157All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1255Open in IMG/M
3300005174|Ga0066680_10622335All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae673Open in IMG/M
3300005178|Ga0066688_10362015All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae939Open in IMG/M
3300005329|Ga0070683_100430690All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1258Open in IMG/M
3300005329|Ga0070683_100978207All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae812Open in IMG/M
3300005329|Ga0070683_101955067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae563Open in IMG/M
3300005345|Ga0070692_10909062Not Available609Open in IMG/M
3300005434|Ga0070709_10145485All Organisms → cellular organisms → Bacteria1633Open in IMG/M
3300005434|Ga0070709_10726092Not Available775Open in IMG/M
3300005435|Ga0070714_101133430All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae763Open in IMG/M
3300005436|Ga0070713_101247838All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium720Open in IMG/M
3300005436|Ga0070713_102037431All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium557Open in IMG/M
3300005439|Ga0070711_100339104All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1205Open in IMG/M
3300005458|Ga0070681_10457530All Organisms → cellular organisms → Bacteria1188Open in IMG/M
3300005458|Ga0070681_10735899All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium902Open in IMG/M
3300005458|Ga0070681_11351324Not Available636Open in IMG/M
3300005518|Ga0070699_100248180All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1590Open in IMG/M
3300005530|Ga0070679_101197403All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae705Open in IMG/M
3300005533|Ga0070734_10012309All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae6151Open in IMG/M
3300005537|Ga0070730_10008691All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8496Open in IMG/M
3300005537|Ga0070730_10146354All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1606Open in IMG/M
3300005542|Ga0070732_10033203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2943Open in IMG/M
3300005542|Ga0070732_10149378All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae1391Open in IMG/M
3300005563|Ga0068855_101455330All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium704Open in IMG/M
3300005564|Ga0070664_101429740All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae654Open in IMG/M
3300005575|Ga0066702_10485203All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium754Open in IMG/M
3300005575|Ga0066702_10766881All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae574Open in IMG/M
3300006028|Ga0070717_11168101All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae701Open in IMG/M
3300006173|Ga0070716_100070825All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae2048Open in IMG/M
3300006423|Ga0075039_1003314All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae629Open in IMG/M
3300006800|Ga0066660_11155081Not Available610Open in IMG/M
3300006903|Ga0075426_10244723All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium → unclassified Acidobacterium → Acidobacterium sp.1305Open in IMG/M
3300006954|Ga0079219_10257460All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae → Acidobacterium1044Open in IMG/M
3300007788|Ga0099795_10132798All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1006Open in IMG/M
3300009093|Ga0105240_11750769All Organisms → cellular organisms → Bacteria648Open in IMG/M
3300010371|Ga0134125_10060361All Organisms → cellular organisms → Bacteria → Acidobacteria4217Open in IMG/M
3300010371|Ga0134125_10070491All Organisms → cellular organisms → Bacteria3887Open in IMG/M
3300010373|Ga0134128_10719281All Organisms → cellular organisms → Bacteria1108Open in IMG/M
3300010373|Ga0134128_10770984All Organisms → cellular organisms → Bacteria1067Open in IMG/M
3300010373|Ga0134128_11915365All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium652Open in IMG/M
3300010375|Ga0105239_10091352All Organisms → cellular organisms → Bacteria3359Open in IMG/M
3300010376|Ga0126381_100040671All Organisms → cellular organisms → Bacteria5636Open in IMG/M
3300010397|Ga0134124_12907431Not Available523Open in IMG/M
3300011269|Ga0137392_10269130All Organisms → cellular organisms → Bacteria1405Open in IMG/M
3300012096|Ga0137389_11048469All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium699Open in IMG/M
3300012202|Ga0137363_10760045Not Available821Open in IMG/M
3300012582|Ga0137358_11080886All Organisms → cellular organisms → Bacteria → Proteobacteria513Open in IMG/M
3300012685|Ga0137397_10275763Not Available1253Open in IMG/M
3300012924|Ga0137413_10436895All Organisms → cellular organisms → Bacteria949Open in IMG/M
3300012924|Ga0137413_11323133All Organisms → cellular organisms → Bacteria579Open in IMG/M
3300012951|Ga0164300_10143121All Organisms → cellular organisms → Bacteria1110Open in IMG/M
3300012955|Ga0164298_10116059All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1445Open in IMG/M
3300012957|Ga0164303_10874020Not Available627Open in IMG/M
3300012960|Ga0164301_10529509All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium856Open in IMG/M
3300012960|Ga0164301_11302168Not Available589Open in IMG/M
3300012960|Ga0164301_11834544All Organisms → cellular organisms → Bacteria511Open in IMG/M
3300012984|Ga0164309_10159931All Organisms → cellular organisms → Bacteria1508Open in IMG/M
3300012984|Ga0164309_10335806All Organisms → cellular organisms → Bacteria1103Open in IMG/M
3300012985|Ga0164308_11348450All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium649Open in IMG/M
3300012988|Ga0164306_10563342Not Available887Open in IMG/M
3300013104|Ga0157370_11187341Not Available689Open in IMG/M
3300018431|Ga0066655_10304761All Organisms → cellular organisms → Bacteria1037Open in IMG/M
3300019789|Ga0137408_1001625All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8400Open in IMG/M
3300019999|Ga0193718_1014133All Organisms → cellular organisms → Bacteria1766Open in IMG/M
3300021170|Ga0210400_10035859All Organisms → cellular organisms → Bacteria3843Open in IMG/M
3300021560|Ga0126371_10056368All Organisms → cellular organisms → Bacteria → Acidobacteria3776Open in IMG/M
3300021560|Ga0126371_12146292Not Available673Open in IMG/M
3300023056|Ga0233357_1022333All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117756Open in IMG/M
3300025544|Ga0208078_1019544All Organisms → cellular organisms → Bacteria1540Open in IMG/M
3300025906|Ga0207699_10283273All Organisms → cellular organisms → Bacteria1152Open in IMG/M
3300025912|Ga0207707_10477883All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1065Open in IMG/M
3300025912|Ga0207707_10491341All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1047Open in IMG/M
3300025913|Ga0207695_10236302All Organisms → cellular organisms → Bacteria1730Open in IMG/M
3300025915|Ga0207693_10241534All Organisms → cellular organisms → Bacteria1418Open in IMG/M
3300025915|Ga0207693_11158293All Organisms → cellular organisms → Bacteria585Open in IMG/M
3300025916|Ga0207663_10229962All Organisms → cellular organisms → Bacteria1354Open in IMG/M
3300025927|Ga0207687_10000297All Organisms → cellular organisms → Bacteria34093Open in IMG/M
3300025928|Ga0207700_10004034All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae8598Open in IMG/M
3300025928|Ga0207700_10250083All Organisms → cellular organisms → Bacteria1514Open in IMG/M
3300025928|Ga0207700_10913811Not Available786Open in IMG/M
3300025929|Ga0207664_11434728Not Available611Open in IMG/M
3300026041|Ga0207639_11156820All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium726Open in IMG/M
3300026331|Ga0209267_1299299Not Available535Open in IMG/M
3300026557|Ga0179587_11154048All Organisms → cellular organisms → Bacteria510Open in IMG/M
3300027512|Ga0209179_1085253All Organisms → cellular organisms → Bacteria698Open in IMG/M
3300027826|Ga0209060_10006477All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae7989Open in IMG/M
3300027842|Ga0209580_10006402All Organisms → cellular organisms → Bacteria → Acidobacteria5039Open in IMG/M
3300027842|Ga0209580_10093074All Organisms → cellular organisms → Bacteria1451Open in IMG/M
3300027857|Ga0209166_10118247All Organisms → cellular organisms → Bacteria1466Open in IMG/M
3300028047|Ga0209526_10790087Not Available589Open in IMG/M
3300030991|Ga0073994_12174835All Organisms → cellular organisms → Bacteria1070Open in IMG/M
3300031047|Ga0073995_11607917All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium969Open in IMG/M
3300031057|Ga0170834_104761106All Organisms → cellular organisms → Bacteria → Terrabacteria group → Cyanobacteria/Melainabacteria group → Cyanobacteria → Nostocales2983Open in IMG/M
3300032174|Ga0307470_11497143All Organisms → cellular organisms → Bacteria561Open in IMG/M
3300033486|Ga0316624_10141836All Organisms → cellular organisms → Bacteria1777Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere15.84%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.89%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil10.89%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil8.91%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere8.91%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil5.94%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.96%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.97%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere2.97%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.98%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.98%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil1.98%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.98%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.99%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.99%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil0.99%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil0.99%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.99%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grass Soil0.99%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.99%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.99%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.99%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.99%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere0.99%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.99%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.99%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2170459010Grass soil microbial communities from Rothamsted Park, UK - December 2009 direct MP BIO1O1 lysis 0-9cm (no DNA from 10 to 21cm!!!)EnvironmentalOpen in IMG/M
2199352024Bare-fallow DEEP SOILEnvironmentalOpen in IMG/M
3300002245Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300005174Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_129EnvironmentalOpen in IMG/M
3300005178Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137EnvironmentalOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005345Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005518Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaGEnvironmentalOpen in IMG/M
3300005530Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaGEnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005564Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaGHost-AssociatedOpen in IMG/M
3300005575Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_151EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006423Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate RNA 2013_056 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006903Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5Host-AssociatedOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300011269Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h3.4A metaGEnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012202Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_115_16 metaGEnvironmentalOpen in IMG/M
3300012582Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_20_16 metaGEnvironmentalOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012924Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012957Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_207_MGEnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013104Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaGHost-AssociatedOpen in IMG/M
3300018431Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_104EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300021170Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-26-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300023056Soil microbial communities from Shasta-Trinity National Forest, California, United States - GEON-SFM-MS2EnvironmentalOpen in IMG/M
3300025544Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 deep-072012 (SPAdes)EnvironmentalOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025912Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025928Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025929Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300026041Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026331Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_137 (SPAdes)EnvironmentalOpen in IMG/M
3300026557Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug2_1_08_16fungalEnvironmentalOpen in IMG/M
3300027512Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027826Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300028047Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M1 (SPAdes)EnvironmentalOpen in IMG/M
3300030991Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031047Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-1B (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300033486Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_N3_C1_D5_AEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
F62_042996702170459010Grass SoilMAGETKAAEKQRRALSLDGWAVGIALVLAVLVRLGVLKHIAW
deeps_039455002199352024SoilMSDQAAEKKPGALSLDGWAVAIALLLAALVRLGVVKHVGW
JGIcombinedJ26739_10032726923300002245Forest SoilMADQVVEKKAARTLSLDGWAVAIALLLAALVRLGVLRHVGW*
C688J35102_12081507313300002568SoilMANQVTQEKPKRSLSLDGWAVAIALLLAALVKLGALKHVGW*
soilH2_1032414523300003324Sugarcane Root And Bulk SoilMGNQVSQKKSKRNLSLDGWAVAIALLLATLVKLGALKHVGW*
Ga0062595_10002621533300004479SoilMSNQAQQEAKRGLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0062595_10019015723300004479SoilMPGEAKVVEKQRRALSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0066680_1062233523300005174SoilMPSKTKAVEKQRRTLSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0066688_1036201523300005178SoilMPGKTKAVEKQRRTLSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0070683_10043069013300005329Corn RhizosphereMGNQVQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0070683_10097820723300005329Corn RhizosphereMANQVTQEKPKRGLSLDGWAVAIALLLATLVKLGALKHVGW*
Ga0070683_10195506723300005329Corn RhizosphereMANQVTQEKAKRGLSLDGWAVGVALLLAALVKLGALKHVGW*
Ga0070692_1090906223300005345Corn, Switchgrass And Miscanthus RhizosphereMANQVTQEKPKKGLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0070709_1014548523300005434Corn, Switchgrass And Miscanthus RhizosphereMANQVTQEKPKRGLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0070709_1072609213300005434Corn, Switchgrass And Miscanthus RhizosphereMADHVTQEKSKRGLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0070714_10113343023300005435Agricultural SoilMAGETKAAEKQRRALSLDGWAVGIALVLAVLVRLGVLKHVGW*
Ga0070713_10124783813300005436Corn, Switchgrass And Miscanthus RhizosphereMANQVTQENPKRGLSLDGWAVGIALLLAALVKLGVLKHVGW*
Ga0070713_10203743113300005436Corn, Switchgrass And Miscanthus RhizosphereMANQVTQQETKRGLSLDGWAVGIALLLAVLVKSGLLKHVGW*
Ga0070711_10033910423300005439Corn, Switchgrass And Miscanthus RhizosphereMADHVTQEKPKRGLSLDGWAVAIALLLAVLVKLGALKHVGW*
Ga0070681_1045753023300005458Corn RhizosphereMANQVPEEKPKRGLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0070681_1073589913300005458Corn RhizosphereMANQVTQEKPKKGLSLDGWALAIALLLAALVKLGALKHVGW*
Ga0070681_1135132413300005458Corn RhizosphereMANQVTQEKPKKSLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0070699_10024818013300005518Corn, Switchgrass And Miscanthus RhizosphereTHQAIKQEIKRGLSLDSWAVGIALLLAALVKLGALKHVGW*
Ga0070679_10119740323300005530Corn RhizosphereMANQLTQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0070734_1001230923300005533Surface SoilMANQVTQEPKRSLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0070730_1000869153300005537Surface SoilMAGETQVVQKQRRVLSLDGWAVGIALLLAVLVRLGVLKHIAW*
Ga0070730_1014635413300005537Surface SoilMANQVTQQETKRGLSLDGWAVAIALLLAALVRLGALKHVGW*
Ga0070732_1003320323300005542Surface SoilMANQVAQEKPKKSLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0070732_1014937823300005542Surface SoilMAGETQAVQKQRKGLSLDGWAVGIALLLALLVRLGVLKHVGW*
Ga0068855_10145533013300005563Corn RhizosphereMGNQVQEKPKRGLSLDGWAVGIALLLAALVKVGALKHVGW*
Ga0070664_10142974023300005564Corn RhizosphereMANLVQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0066702_1048520313300005575SoilMANQVTPEKAKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0066702_1076688123300005575SoilMATQIAQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0070717_1116810123300006028Corn, Switchgrass And Miscanthus RhizosphereMADQVTQENPKRGLSLDGWAVGIALLLAALVKLGVLKHVGW*
Ga0070716_10007082533300006173Corn, Switchgrass And Miscanthus RhizosphereNKEDKQMPGEAKVVEKQRRALSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0075039_100331413300006423Permafrost SoilMADQVAEKKTRTLSLDGWAVGIALLLAALVRLGLLKHVGW*
Ga0066660_1115508113300006800SoilMANQIAQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0075426_1024472323300006903Populus RhizosphereMADETKPVQKQRRVLSLDGWAVGIALLLAALVRLGVLKHVGW*
Ga0079219_1025746013300006954Agricultural SoilMAGETKAVEKQRRVLSLDGWAVGIALLLAALVRLGVLKHVGW*
Ga0099795_1013279823300007788Vadose Zone SoilMADQVVEKKAARTLSLDGWAVAIALLLAALVRLGALKHIGW*
Ga0105240_1175076923300009093Corn RhizosphereMGNQVQEKPKRGLSLDGWAVGIALLLAALVKLVALKHVGW*
Ga0134125_1006036113300010371Terrestrial SoilMGDRAMTHQAIKQEIKRGLSLDSWAVGIALLLAALVKLGALKHVGW*
Ga0134125_1007049123300010371Terrestrial SoilMANQITQENLKRSLSLDGWAVAIALLLAVLVKLGVLKHVGW*
Ga0134128_1071928123300010373Terrestrial SoilNQAQQEAKRGLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0134128_1077098413300010373Terrestrial SoilNYRRIKQMPNEVTQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0134128_1191536523300010373Terrestrial SoilAQENLKRSLSLDGWAVAIALLLAVLVKLGVLKHVGW*
Ga0105239_1009135243300010375Corn RhizosphereMANQVTQEKSQRGLSLDGWAVAIALLLATLVKLGALKHVGW*
Ga0126381_10004067113300010376Tropical Forest SoilMAGETQAVQKQRRALSLDGWAVGIALLLAALVRLGILKHIAW*
Ga0134124_1290743113300010397Terrestrial SoilMANQVTQGKSKRSLSLDGWAVAIALLLAALVKLGA
Ga0137392_1026913023300011269Vadose Zone SoilMADQVVKKKAARTLSLDGWAVAIALLLAALVRLGVLKHVGW*
Ga0137389_1104846923300012096Vadose Zone SoilQVVEKKAERALSLDGWAVAIALLLAALVRLGVLKHVGW*
Ga0137363_1076004523300012202Vadose Zone SoilMPGKTKAVEKQRRALSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0137358_1108088623300012582Vadose Zone SoilMEESKMADQVVEKKAARSLSLDGWAVAIALLLAALVRLGVLKHVGW*
Ga0137397_1027576323300012685Vadose Zone SoilMANQVTQEKSKRSLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0137413_1043689513300012924Vadose Zone SoilMADQTTRQDTKRGLSLDGWAVAIALLLATLVKLGALKHVGW*
Ga0137413_1132313313300012924Vadose Zone SoilMADQVVEKKAARSLSLDGWAVAIALLLAALVRLGALKHIGW*
Ga0164300_1014312123300012951SoilMPGETKVVEKRRRTLSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0164298_1011605923300012955SoilMSDQAAEKKRRALSLDGWAVGIALLLAALVRLGVVKHVGW*
Ga0164303_1087402013300012957SoilMSDQAAEKKPGALSLDGWAVGIALLLAALVRLVVVKDVGW*
Ga0164301_1052950923300012960SoilMANQVTQGKSKRSLSLDGWAVAIALLLAALVKLGALKHVGW*
Ga0164301_1130216813300012960SoilMPGEAKVVEKQRRGLSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0164301_1183454423300012960SoilETKVVEKQRRALSLDGWAVEITLLLTALIRLGVLKHIA*
Ga0164309_1015993113300012984SoilMSDQAAEKKPGALSLDGWAVAIALLLAALVRLGVVKHVGW*
Ga0164309_1033580623300012984SoilMPGETKVVEKRRRALSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0164308_1134845023300012985SoilVQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0164306_1056334223300012988SoilMMNKEAKQMADETKAVEKQRRALSLDGWAVGIALLLAALVRLGVLKHIAW*
Ga0157370_1118734123300013104Corn RhizosphereMRNQVQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW*
Ga0066655_1030476133300018431Grasslands SoilMATQIAQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW
Ga0137408_100162533300019789Vadose Zone SoilMADQVVEKKAARSLSLDGWAVAIALLLAALVRLGVLKHVGW
Ga0193718_101413313300019999SoilMADQVVEKKAARTLSLDGWAVAIALLLAALVRLGVLKHVGW
Ga0210400_1003585933300021170SoilMADQVVKKKAARTLSLDGWAVAIALLLAALVRLGVLKHVGW
Ga0126371_1005636823300021560Tropical Forest SoilMANQVAQEKPKKGLSLDGWAVGIALLLAVLVKLGALKHVGW
Ga0126371_1214629213300021560Tropical Forest SoilMANQVTREKSKRSLSLDGWAVAIALLLAALVKLGALKHV
Ga0233357_102233323300023056SoilMEDQVAEKKTKDLSLDGWAVAIALLLAALVRLGVLKHVGW
Ga0208078_101954423300025544Arctic Peat SoilMADHAVEKKTRTLSLDGWAVAIALLLAALVRLGVLKHIGW
Ga0207699_1028327323300025906Corn, Switchgrass And Miscanthus RhizosphereGEAKVVEKQRRALSLDGWAVGIALLLAALVRLGVLKHIAW
Ga0207707_1047788323300025912Corn RhizosphereMANQVPEEKPKRGLSLDGWAVAIALLLAALVKLGALKHVGW
Ga0207707_1049134113300025912Corn RhizosphereMGNQVQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW
Ga0207695_1023630233300025913Corn RhizosphereMANLVQEKPKRGLSLDGWAVGIALLLAALVKLGALKHVGW
Ga0207693_1024153423300025915Corn, Switchgrass And Miscanthus RhizosphereMANQVTQETPKRGLSLDGWAVGIALLLAALVKLGVLKHVGW
Ga0207693_1115829323300025915Corn, Switchgrass And Miscanthus RhizosphereMANQVTQGKSKRSLSLDGWAVAIALLLAALVKLGALKHVGW
Ga0207663_1022996223300025916Corn, Switchgrass And Miscanthus RhizosphereMADHVTQEKPKRGLSLDGWAVAIALLLAVLVKLGALKHVGW
Ga0207687_10000297183300025927Miscanthus RhizosphereMANQVTQEKSQRGLSLDGWAVAIALLLAALVKLGALKHVGW
Ga0207700_1000403463300025928Corn, Switchgrass And Miscanthus RhizosphereMADQVTQEKPKKSLSLDGWAVATALLLAALVKLGALKHVGW
Ga0207700_1025008323300025928Corn, Switchgrass And Miscanthus RhizosphereMPGEAKVVEKQRRALSLDGWAVGIALLLAALVRLGVLKHI
Ga0207700_1091381123300025928Corn, Switchgrass And Miscanthus RhizosphereMAGETKAVEKQRRALSLDGWAVGIALLLAALVRLGVLKHVGW
Ga0207664_1143472823300025929Agricultural SoilMAGETKAAEKQRRALSLDGWAVGIALLLAALVRLGVLKHIAW
Ga0207639_1115682023300026041Corn RhizosphereMADQVTQEKPKKGLSLDGWAVAIALLLAALVKLGALKHVGW
Ga0209267_129929913300026331SoilMPGKTKAVEKQRRTLSLDGWAVGIALLLAALVRLGVLKH
Ga0179587_1115404813300026557Vadose Zone SoilMADQVVEKKAARTLSLDGWAVAIALLLAVLVRLGVLKHVGW
Ga0209179_108525323300027512Vadose Zone SoilMADQVVEKKAARTLSLDGWAVAIALLLAALVRLGALKHIGW
Ga0209060_1000647753300027826Surface SoilMANQVTQEPKRSLSLDGWAVGIALLLAALVKLGALKHVGW
Ga0209580_1000640253300027842Surface SoilMANQVAQEKPKKSLSLDGWAVGIALLLAALVKLGALKHVGW
Ga0209580_1009307423300027842Surface SoilMAGETQAVQKQRKGLSLDGWAVGIALLLALLVRLGVLKHVGW
Ga0209166_1011824723300027857Surface SoilMAGETQVVQKQRRVLSLDGWAVGIALLLAVLVRLGVLKHIAW
Ga0209526_1079008723300028047Forest SoilMADQVVEKKEARTLSLDGWAVAIALLLAALVRLGVLRHVGW
Ga0073994_1217483523300030991SoilMADQAVEKKSARTLSLDGWAVAIALLLAALVRLGVLKHVGW
Ga0073995_1160791713300031047SoilMADQAVEKKSARNLSLDGWAVAIALLLAALIRLGVLKHVGW
Ga0170834_10476110623300031057Forest SoilMANQVTQEKSKISLSLDGWAVAIALLLAALVKLGALKHVGW
Ga0307470_1149714313300032174Hardwood Forest SoilMAEQDENKSARQLSLDSWAVAIALLLAVLVRLGVLKHVGW
Ga0316624_1014183613300033486SoilMAGETKAIQKQRRALSLDGWAVGIALLLAALVRLGVLKH

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.