Basic Information | |
---|---|
Family ID | F103972 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 101 |
Average Sequence Length | 45 residues |
Representative Sequence | MALTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLF |
Number of Associated Samples | 89 |
Number of Associated Scaffolds | 101 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 83.17 % |
% of genes near scaffold ends (potentially truncated) | 26.73 % |
% of genes from short scaffolds (< 2000 bps) | 83.17 % |
Associated GOLD sequencing projects | 81 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.49 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (60.396 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere (11.881 % of family members) |
Environment Ontology (ENVO) | Unclassified (29.703 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (39.604 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Transmembrane (alpha-helical) | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 52.70% β-sheet: 0.00% Coil/Unstructured: 47.30% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.49 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 101 Family Scaffolds |
---|---|---|
PF07238 | PilZ | 53.47 |
PF00196 | GerE | 11.88 |
PF13537 | GATase_7 | 0.99 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 60.40 % |
All Organisms | root | All Organisms | 39.60 % |
Visualization |
---|
Powered by ApexCharts |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 11.88% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 7.92% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 6.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 6.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 5.94% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.95% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 4.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.95% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 3.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.96% |
Soil | Environmental → Terrestrial → Soil → Loam → Grasslands → Soil | 3.96% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 3.96% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.97% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 2.97% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 2.97% |
Switchgrass Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.98% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.98% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.98% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.98% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 1.98% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.99% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.99% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 0.99% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 0.99% |
Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 0.99% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.99% |
Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 0.99% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.99% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.99% |
Avena Fatua Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere | 0.99% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2088090014 | Soil microbial communities from Great Prairies - Iowa, Native Prairie soil | Environmental | Open in IMG/M |
3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Host-Associated | Open in IMG/M |
3300001305 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300001686 | Grasslands soil microbial communities from Hopland, California, USA | Environmental | Open in IMG/M |
3300002568 | Grasslands soil microbial communities from Hopland, California, USA - 2 | Environmental | Open in IMG/M |
3300004022 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 | Environmental | Open in IMG/M |
3300004114 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5 | Environmental | Open in IMG/M |
3300004157 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - - Combined assembly of AARS Block 2 | Environmental | Open in IMG/M |
3300004463 | Combined assembly of Arabidopsis thaliana microbial communities | Host-Associated | Open in IMG/M |
3300004479 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAs | Environmental | Open in IMG/M |
3300004480 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4 | Environmental | Open in IMG/M |
3300004643 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3 | Environmental | Open in IMG/M |
3300005160 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB | Environmental | Open in IMG/M |
3300005164 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAC | Environmental | Open in IMG/M |
3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
3300005294 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 Bulk Soil | Environmental | Open in IMG/M |
3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Environmental | Open in IMG/M |
3300005526 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 | Environmental | Open in IMG/M |
3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Environmental | Open in IMG/M |
3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Environmental | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
3300006049 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 | Host-Associated | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006605 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006847 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006853 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD4 | Host-Associated | Open in IMG/M |
3300007076 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Host-Associated | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009609 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 | Environmental | Open in IMG/M |
3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300011432 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT718_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300011442 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT138_2 | Environmental | Open in IMG/M |
3300011443 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT630_2 | Environmental | Open in IMG/M |
3300012173 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT517_2 | Environmental | Open in IMG/M |
3300012469 | Combined assembly of Soil carbon rhizosphere | Host-Associated | Open in IMG/M |
3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012896 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2 | Environmental | Open in IMG/M |
3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redo | Environmental | Open in IMG/M |
3300024181 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK34 | Environmental | Open in IMG/M |
3300024224 | Soil microbial communities from Purdue University Martell Research Forest, Indiana, United States - CNK14 | Environmental | Open in IMG/M |
3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) | Environmental | Open in IMG/M |
3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027056 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30 (SPAdes) | Environmental | Open in IMG/M |
3300027513 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMLT890 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027821 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes) | Environmental | Open in IMG/M |
3300027873 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027909 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes) | Host-Associated | Open in IMG/M |
3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028592 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Cellulose_Day30 | Environmental | Open in IMG/M |
3300028792 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 19_S | Environmental | Open in IMG/M |
3300028812 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Vanillin_Day48 | Environmental | Open in IMG/M |
3300031152 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_S | Environmental | Open in IMG/M |
3300031184 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 13_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031547 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4 | Environmental | Open in IMG/M |
3300031720 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM2C_515 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300032075 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T20D3 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
GPIPI_02939730 | 2088090014 | Soil | LTPLETEGAAQLRGPDADLWRTLAAWLWMAYLMLMSGAVLWWLF |
ARCol0yngRDRAFT_10087101 | 3300000652 | Arabidopsis Rhizosphere | MALTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWL |
C688J14111_100173511 | 3300001305 | Soil | MALTPVETEGAGELRGPDADMWRTLAAWLWMTYLGLLTGAVLWWLL* |
C688J18823_100171119 | 3300001686 | Soil | MALTPVETEGAGQLRGPDADMWRTLAAWLWMTYLGLLTGAVLWWLL* |
C688J18823_109208521 | 3300001686 | Soil | MALTPVETEGTAQLRGPDADMWRTLAAWLWMAYLMLLTGAVLWWLL* |
C688J35102_1181265951 | 3300002568 | Soil | MALTPVETEGAAQLGGPDADMWRTLAAWLWMTYLMLLTGAVLWWLL* |
Ga0055432_101938091 | 3300004022 | Natural And Restored Wetlands | KGSMAMRQLDTEGAPLAGPDGDMWRTAAAWLWTTYLMLVTGAVLYWVF* |
Ga0062593_1034896441 | 3300004114 | Soil | MAMTPLETEVAAQLRGPDADLWRTLAAWLWMTYLLLLTGAVLWWLF* |
Ga0062590_1004491682 | 3300004157 | Soil | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFLWWLF* |
Ga0062590_1010005551 | 3300004157 | Soil | MALTPLETEGAAQLRGPDADLWRTLAAWLWMSYLVLVTGAVLWWLF* |
Ga0063356_1015334691 | 3300004463 | Arabidopsis Thaliana Rhizosphere | MAFRSLDTEGAAGTPRLREPDADMWRTLAAWLWTSYLVLVTGAILWWVF* |
Ga0062595_1018270162 | 3300004479 | Soil | MALTPLETEGAAQLGGPEADVWRTFAAWLWMAYLFLVTGAVLWWFF* |
Ga0062592_1013445822 | 3300004480 | Soil | MAMTPLETEGAAQLRGPDADMWRTLAAWLWMTYLLLVTGAVLWWVF* |
Ga0062591_1026290611 | 3300004643 | Soil | MALTPLETEGAAQLGGPEADVWRTFAAWLWMAYLFLVTGTVLWWFF* |
Ga0066820_10209451 | 3300005160 | Soil | MAMTPLETEGTAQLRGPDADMWRTLAAWLWMTYLLLVTGAVLWWVF* |
Ga0066815_100969931 | 3300005164 | Soil | MAMTPLETEGAAQLRGPDADLWRTLAAWLWMSYLVLVTGAILWWLF* |
Ga0065704_102355123 | 3300005289 | Switchgrass Rhizosphere | MALTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLF* |
Ga0065705_102185093 | 3300005294 | Switchgrass Rhizosphere | MAFTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLL* |
Ga0065707_107145511 | 3300005295 | Switchgrass Rhizosphere | MAMTPLETEGAAQLRGPDADLWRTLAAWLWMSYLVLVTGAVLWWLF* |
Ga0066388_1001789034 | 3300005332 | Tropical Forest Soil | MAMRPLDTEGAQLRGPDADMWRTLAAWLWTSYLMLVTGAILWWFF* |
Ga0066388_1022719972 | 3300005332 | Tropical Forest Soil | MALTPLETEGAAQLGGPEADVWRTFAAWLWMAYLFLVAGAVLWWFF* |
Ga0070692_106557122 | 3300005345 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTPLETEGAAQLRGPDADLWRTLAAWLWMTYLFLVTGAVLWWLL* |
Ga0073909_100178892 | 3300005526 | Surface Soil | MALTPLETEGAAPLSGPDADTWRTLAAWLWMTYLLLVTGAVLWWLG* |
Ga0070684_1004630362 | 3300005535 | Corn Rhizosphere | MALTPLETEGAAQLGGPEADVWRTFAAWLWMAYLFLVTGALLWWFF* |
Ga0070704_1017897241 | 3300005549 | Corn, Switchgrass And Miscanthus Rhizosphere | MAFRSLDTEGAAGTPRLREPAADMWRTLAAWLWTSYLVLVTGAILWWVF* |
Ga0068852_1008124463 | 3300005616 | Corn Rhizosphere | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFLWW |
Ga0068859_10002698712 | 3300005617 | Switchgrass Rhizosphere | ASRERSMALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFLWWLF* |
Ga0066905_1000591233 | 3300005713 | Tropical Forest Soil | MALRRLDTEAAAQLDGADADMWRTLAAWLWTTYLAVVTGAVLWWVF* |
Ga0066905_1012181992 | 3300005713 | Tropical Forest Soil | MTIRPLDTEGAPLRGPDADMWRTAAAWLWTAYLTLVTGAILWWVF* |
Ga0068861_1003632981 | 3300005719 | Switchgrass Rhizosphere | MALTPLETEGAAQLGGPEADVWRTLAAWLWMAYLFLVTGAVLWWFF* |
Ga0066903_1008657901 | 3300005764 | Tropical Forest Soil | MALTPLEAEGAAHLRGPDADLWRTLAAWLWMTYLALVTGAVLWWLS* |
Ga0068862_1024403242 | 3300005844 | Switchgrass Rhizosphere | MAFRSLDTEEAAGTPRLRGPDADMWRTLAAWLWTSYLVLVTG |
Ga0075417_100275221 | 3300006049 | Populus Rhizosphere | MALTPLETDGAAQLRGQDADLWRTLAAWLWMTYLFLVTGAVLWWLL* |
Ga0070715_102238362 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTPLETEGTAQLGGPEADLWRTFAAWLWMAYLFLVSGAVLWWFF* |
Ga0074057_116181651 | 3300006605 | Soil | MAMTRLETESAAQLRGPDADMWRTLAAWLWMSYLVLVTGAVLWWVF* |
Ga0075421_1003274741 | 3300006845 | Populus Rhizosphere | DGAAQLRGQDADLWRTLAAWLWMTYLFLVTGAVLWWLL* |
Ga0075431_1003610811 | 3300006847 | Populus Rhizosphere | MALTPFDTEGVAPLRGPEADMWRTLAAWLWTTYLALVTGAVLWWVF* |
Ga0075433_112295631 | 3300006852 | Populus Rhizosphere | MALTPLDTEGAAQLRGPDADLWRTLAAWLWMTYLLLVAGAVLWWLF* |
Ga0075420_1003182531 | 3300006853 | Populus Rhizosphere | VTSAEQEDTPKVGSMALTPFDTEGVAPLRGPEADMWRTLAAWLWTTYLALVTGAVLWWVF |
Ga0075435_1019057532 | 3300007076 | Populus Rhizosphere | MALTPLDTEGAAQLRGPDADLWRTLAAWLWMTYLLLVAGA |
Ga0099791_100230293 | 3300007255 | Vadose Zone Soil | MALTPLETEGAAHLGGPDADLWRTLAAWLWMAYLVLVSGAVLWWVL* |
Ga0111538_113314322 | 3300009156 | Populus Rhizosphere | MALTPLDTEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLF* |
Ga0111538_136219621 | 3300009156 | Populus Rhizosphere | MAFTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTG |
Ga0075423_115591171 | 3300009162 | Populus Rhizosphere | TPLETEVAAQLRGPDADLWRTLAAWLWMTYLFLVTGAVLWWLL* |
Ga0105242_116230342 | 3300009176 | Miscanthus Rhizosphere | MALTPLETEGAAQLGGPEADVWRTLAAWLWMAYLFLVTGTVLWWFF* |
Ga0105347_10730812 | 3300009609 | Soil | MTPVGRREGRSMALRSLDTEEAPPLSGPDADMWRTLAAWLWATYLMLVTGAILWWVF* |
Ga0105347_14298851 | 3300009609 | Soil | MRTLDTEGAPLAGPDADMWRTAAAWLWTTYLMLVTGAVLYWVF* |
Ga0126384_100573605 | 3300010046 | Tropical Forest Soil | MALTPLETEATAQLGGPEADVWRTFAAWLWMAYLFLVTGAVLWWFL* |
Ga0126376_110479811 | 3300010359 | Tropical Forest Soil | MALTPLETEGAAQLGGPEADVWRTYAAWLWMAYLFLVTGAVLWWFF* |
Ga0126377_119951161 | 3300010362 | Tropical Forest Soil | RGGLMTIRPLDTEGAPLRGPDADMWRTAAAWLWTAYLTLVTGAILWWVF* |
Ga0134124_100062861 | 3300010397 | Terrestrial Soil | MALTPLETEGAAQLGGPDADLWRTLAAWLWMTYLLLVTGAVLWWLL* |
Ga0134124_111004461 | 3300010397 | Terrestrial Soil | MTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLF* |
Ga0134127_108148133 | 3300010399 | Terrestrial Soil | MAFRSLDTEGAAGTPRLRGPDADMWRTLAAWLWTSYLVLVTGA |
Ga0134127_126357491 | 3300010399 | Terrestrial Soil | MTPLETEGAGQLRGPDADMWRTLAAWLWMTYLFLVTGAVLWWLF* |
Ga0134123_115385191 | 3300010403 | Terrestrial Soil | MALTPLETEGAAQLGGPDADLWRTLAAWLWMTYLLLVTGAVPWWLL* |
Ga0137428_10413801 | 3300011432 | Soil | MALRSLDTEEAPPLSGPDADMWRTLAAWLWATYLMLVTGA |
Ga0137432_10204173 | 3300011439 | Soil | MALRSLDTEEAPRLRGPDADMWRTLAAWLWATYLMLVTGAILWWVF* |
Ga0137437_11231541 | 3300011442 | Soil | MALTPLETEGAAQLGGPDADLWRTLAAWLWMTYLVLVTSAVLWWLF* |
Ga0137457_11103802 | 3300011443 | Soil | DTEGAPLAGPDADMWRTAAAWLWTTYLMLVTGAVLYWVF* |
Ga0137327_11206551 | 3300012173 | Soil | MTPVGRREGRSMALRSLDTEEAPPLSGPDADMWRTLAAWLWATYLMLVTGAI |
Ga0150984_1158465182 | 3300012469 | Avena Fatua Rhizosphere | MALTPVETEGAVQLGGPDADMWRTLAAWLWMTYLMLLTGAVLWWLL* |
Ga0157316_10023563 | 3300012510 | Arabidopsis Rhizosphere | MALTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLL* |
Ga0137397_100593644 | 3300012685 | Vadose Zone Soil | MALTPLETEGAAHLGGRDADLWRTLAAWLWMAYLVLVSGAVLWWVL* |
Ga0157303_103134322 | 3300012896 | Soil | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVT |
Ga0126375_101456891 | 3300012948 | Tropical Forest Soil | MRPLDTEGAQLRGPDADMWRTLAAWLWTAYLMLITGAILWWFF* |
Ga0164309_108890141 | 3300012984 | Soil | EGAAPLSGPDADTWRTLAAWLWMTYLLLVTGAVLWWLG* |
Ga0164307_101762383 | 3300012987 | Soil | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLG* |
Ga0184628_101142432 | 3300018083 | Groundwater Sediment | MALTPLETEGAAQLGGPDADLWRTLAAWLWMTYLVLVTSAVLWWLF |
Ga0206353_101797882 | 3300020082 | Corn, Switchgrass And Miscanthus Rhizosphere | ETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFLWWLF |
Ga0210380_101562343 | 3300021082 | Groundwater Sediment | MALTPLETEGAAQLGGPDADLWRTLAAWLWMTYLVLVTSAVL |
Ga0247693_10367191 | 3300024181 | Soil | MALTPLETEGTAQLGGPEADVWRTFAAWLWMAYLFLVSGAVLWWFF |
Ga0247673_10357231 | 3300024224 | Soil | MALTPLETEGAAQLGGPEADVWRTFAAWLWMAYLFLVSGAVLWWFF |
Ga0207666_10376841 | 3300025271 | Corn, Switchgrass And Miscanthus Rhizosphere | SMALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFLWWLF |
Ga0207646_112863752 | 3300025922 | Corn, Switchgrass And Miscanthus Rhizosphere | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLL |
Ga0207644_109662641 | 3300025931 | Switchgrass Rhizosphere | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTG |
Ga0207641_104917394 | 3300026088 | Switchgrass Rhizosphere | MALTPLETEGAAQLRGPDADLWRTLAAWLWMSYLVLVTGAVLWWLF |
Ga0207641_110083972 | 3300026088 | Switchgrass Rhizosphere | MALTPLETEGAAQLGGPDADLWRTLAAWLWMTYLLLVTGAVLWWLL |
Ga0207674_123002642 | 3300026116 | Corn Rhizosphere | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFL |
Ga0207675_1004033602 | 3300026118 | Switchgrass Rhizosphere | MALTPLETEGAAQLGGPEADVWRTLAAWLWMAYLFLVTGAVLWWFF |
Ga0209879_10588351 | 3300027056 | Groundwater Sand | MAMRTLDTEGAPLAGPDADMWRTAAAWLWTTYLMLVTGAVLYWVF |
Ga0208685_10464332 | 3300027513 | Soil | MALRSLDTEEAPPLSGPDADMWRTLAAWLWATYLMLVTGAILWWVF |
Ga0209388_11991221 | 3300027655 | Vadose Zone Soil | MALTPLETEGAAHLGGPDADLWRTLAAWLWMAYLVLVSGAVLWWVL |
Ga0209811_100076965 | 3300027821 | Surface Soil | MALTPLETEGAAPLSGPDADTWRTLAAWLWMTYLLLVTGAVLWWLG |
Ga0209811_102775372 | 3300027821 | Surface Soil | MAMTPLETEGTAQLRGPDADMWRTLAAWLWMTYLLLVTGAVLWWVF |
Ga0209814_101094213 | 3300027873 | Populus Rhizosphere | MALTPLETDGAAQLRGQDADLWRTLAAWLWMTYLFLVTGAVLWWLL |
Ga0209481_105985221 | 3300027880 | Populus Rhizosphere | MALTPFDTEGVAPLRGPEADMWRTLAAWLWTTYLALVTGAVLWWVF |
Ga0209382_102845216 | 3300027909 | Populus Rhizosphere | DGAAQLRGQDADLWRTLAAWLWMTYLFLVTGAVLWWLL |
Ga0268265_113289581 | 3300028380 | Switchgrass Rhizosphere | MALTPLETEAAAELRGPDADLWRTLAAWLWMTYLLLVTGAFLWWL |
Ga0247822_102500113 | 3300028592 | Soil | MRLLDTEGAPLAGPDADMWRTAAAWLWTTYLMLVTGAVLYWVF |
Ga0307504_100014853 | 3300028792 | Soil | MALSPLEAEGAAELREPDADLWRTLAAWLWMTYLLLVTGAVLWWLS |
Ga0247825_105702842 | 3300028812 | Soil | MALTPLETEGAAQLRGPDADLWRTLAAWLWMTYLMLVTGAVLWWLL |
Ga0307501_100002615 | 3300031152 | Soil | MAMTPLETEGAAQLRGPDADMWRTLAAWLWMTYLSLVTSAVLWWLF |
Ga0307499_100017445 | 3300031184 | Soil | MAMTPLEIEGAGQLRGPDADMWRTLAAWLWMAYLILVTGAVLWWLF |
Ga0307495_100879252 | 3300031199 | Soil | MTPLETEGAAHLHGPDADLWRTLAAWLWMTYLALVTGAVLWWVF |
Ga0310887_101423701 | 3300031547 | Soil | MAFTPLETEGAAQLRGPDADLWRTLAAWLWMTYLLLVTGAVLWWLL |
Ga0307469_106071133 | 3300031720 | Hardwood Forest Soil | MALTPLDTAGTAQLRGPDADLWRTLAAWLWMTYLLLVAGAFLWWLF |
Ga0307468_1000051959 | 3300031740 | Hardwood Forest Soil | MALTPLETDGPAQLRGPDADMWRTLAAWLWMTYLLLVTGAVLWWVF |
Ga0307468_1006236381 | 3300031740 | Hardwood Forest Soil | MALTPLETEGTAQLRGPDADLWRTLAAWLWMTYLLLVAGAFLWWLF |
Ga0307468_1010516681 | 3300031740 | Hardwood Forest Soil | MAMRQLDTEGAPLRGPDADLWRTLAAWLWTTYLMLVTGAILWWVF |
Ga0307473_102180232 | 3300031820 | Hardwood Forest Soil | MRLDTEGAPLAGPDADMWRTAAAWLWTTYLMLVTGAVLYWVF |
Ga0310890_102373242 | 3300032075 | Soil | MALRRLDTESAPHLHGADADMWRTLAAWLWTTYLAVVTGAVVWWVF |
⦗Top⦘ |