Metagenome Family F104254

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences

Select file to download:
Download

Overview

Basic Information
Family ID	F104254
Family Type	Metagenome
Number of Sequences	100
Average Sequence Length	41 residues
Representative Sequence	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK
Number of Associated Samples	33
Number of Associated Scaffolds	100

Quality Assessment
Transcriptomic Evidence	No
Most common taxonomic group	Bacteria
% of genes with valid RBS motifs	1.01 %
% of genes near scaffold ends (potentially truncated)	99.00 %
% of genes from short scaffolds (< 2000 bps)	35.00 %
Associated GOLD sequencing projects	23
AlphaFold2 3D model prediction	No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.

Hidden Markov Model


Click on a Sequence Logo column to get its information.
Powered by Skylign

Most Common Taxonomy
Group	Bacteria (94.000 % of family members)
NCBI Taxonomy ID	2
Taxonomy	All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge (54.000 % of family members)
Environment Ontology (ENVO)	Unclassified (100.000 % of family members)
Earth Microbiome Project Ontology (EMPO)	Free-living → Non-saline → Water (non-saline) (67.000 % of family members)

Multiple Sequence Alignments

Full Alignment
Alignment of all the sequences in the family.

Powered by MSAViewer

Seed Alignment
Alignment of a non-redundant set of sequences, used to build the family's HMM profile.

Powered by MSAViewer

AlphaFold2 Input Alignment
Refined alignment used as input for AlphaFold2.

Powered by MSAViewer

Select alignment to view:

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification:	Globular	Signal Peptide:	No	Secondary Structure distribution:	α-helix: 27.50% β-sheet: 0.00% Coil/Unstructured: 72.50%
Feature Viewer

Powered by Feature Viewer

Gene Neighborhood

Neighboring Pfam domains

Pfam ID	Name	% Frequency in 100 Family Scaffolds
PF02620	YceD	6.00
PF07661	MORN_2	5.00
PF08245	Mur_ligase_M	5.00
PF01553	Acyltransferase	4.00
PF03793	PASTA	4.00
PF03721	UDPG_MGDP_dh_N	3.00
PF00929	RNase_T	2.00
PF00496	SBP_bac_5	2.00
PF00041	fn3	2.00
PF00561	Abhydrolase_1	2.00
PF14903	WG_beta_rep	2.00
PF09827	CRISPR_Cas2	2.00
PF13742	tRNA_anti_2	2.00
PF00677	Lum_binding	2.00
PF01551	Peptidase_M23	2.00
PF04468	PSP1	2.00
PF14289	DUF4369	2.00
PF01476	LysM	2.00
PF01170	UPF0020	2.00
PF01790	LGT	1.00
PF00294	PfkB	1.00
PF02926	THUMP	1.00
PF00795	CN_hydrolase	1.00
PF10365	DUF2436	1.00
PF13573	SprB	1.00
PF00829	Ribosomal_L21p	1.00
PF08281	Sigma70_r4_2	1.00
PF02545	Maf	1.00
PF02348	CTP_transf_3	1.00
PF00156	Pribosyltran	1.00
PF01656	CbiA	1.00
PF02801	Ketoacyl-synt_C	1.00
PF01609	DDE_Tnp_1	1.00
PF13585	CHU_C	1.00
PF13292	DXP_synthase_N	1.00
PF03485	Arg_tRNA_synt_N	1.00
PF01048	PNP_UDP_1	1.00
PF12724	Flavodoxin_5	1.00
PF00403	HMA	1.00
PF00528	BPD_transp_1	1.00
PF02272	DHHA1	1.00
PF11551	Omp28	1.00
PF13715	CarbopepD_reg_2	1.00
PF08126	Propeptide_C25	1.00
PF01712	dNK	1.00
PF07973	tRNA_SAD	1.00
PF01293	PEPCK_ATP	1.00
PF01965	DJ-1_PfpI	1.00
PF01255	Prenyltransf	1.00
PF00590	TP_methylase	1.00
PF03938	OmpH	1.00
PF09603	Fib_succ_major	1.00
PF13505	OMP_b-brl	1.00
PF01725	Ham1p_like	1.00
PF04545	Sigma70_r4	1.00
PF02577	BFN_dom	1.00
PF04397	LytTR	1.00
PF00085	Thioredoxin	1.00
PF05746	DALR_1	1.00

COG ID	Name	Functional Category	% Frequency in 100 Family Scaffolds
COG1399	23S rRNA accumulation protein YceD (essential in plants, uncharacterized in bacteria)	Translation, ribosomal structure and biogenesis [J]	6.00
COG2849	Antitoxin component YwqK of the YwqJK toxin-antitoxin module	Defense mechanisms [V]	5.00
COG0240	Glycerol-3-phosphate dehydrogenase	Energy production and conversion [C]	3.00
COG0677	UDP-N-acetyl-D-mannosaminuronate dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	3.00
COG1004	UDP-glucose 6-dehydrogenase	Cell wall/membrane/envelope biogenesis [M]	3.00
COG1250	3-hydroxyacyl-CoA dehydrogenase	Lipid transport and metabolism [I]	3.00
COG1893	Ketopantoate reductase	Coenzyme transport and metabolism [H]	3.00
COG0018	Arginyl-tRNA synthetase	Translation, ribosomal structure and biogenesis [J]	2.00
COG0116	23S rRNA G2445 N2-methylase RlmL	Translation, ribosomal structure and biogenesis [J]	2.00
COG0286	Type I restriction-modification system, DNA methylase subunit	Defense mechanisms [V]	2.00
COG0307	Riboflavin synthase alpha chain	Coenzyme transport and metabolism [H]	2.00
COG1041	tRNA G10 N-methylase Trm11	Translation, ribosomal structure and biogenesis [J]	2.00
COG1092	23S rRNA G2069 N7-methylase RlmK or C1962 C5-methylase RlmI	Translation, ribosomal structure and biogenesis [J]	2.00
COG1774	Cell fate regulator YaaT, PSP1 superfamily (controls sporulation, competence, biofilm development)	Signal transduction mechanisms [T]	2.00
COG2226	Ubiquinone/menaquinone biosynthesis C-methylase UbiE/MenG	Coenzyme transport and metabolism [H]	2.00
COG2263	Predicted RNA methylase	General function prediction only [R]	2.00
COG2264	Ribosomal protein L11 methylase PrmA	Translation, ribosomal structure and biogenesis [J]	2.00
COG2265	tRNA/tmRNA/rRNA uracil-C5-methylase, TrmA/RlmC/RlmD family	Translation, ribosomal structure and biogenesis [J]	2.00
COG2813	16S rRNA G1207 or 23S rRNA G1835 methylase RsmC/RlmG	Translation, ribosomal structure and biogenesis [J]	2.00
COG2890	Methylase of polypeptide chain release factors	Translation, ribosomal structure and biogenesis [J]	2.00
COG4123	tRNA1(Val) A37 N6-methylase TrmN6	Translation, ribosomal structure and biogenesis [J]	2.00
COG0020	Undecaprenyl pyrophosphate synthase	Lipid transport and metabolism [I]	1.00
COG0127	Inosine/xanthosine triphosphate pyrophosphatase, all-alpha NTP-PPase family	Nucleotide transport and metabolism [F]	1.00
COG0261	Ribosomal protein L21	Translation, ribosomal structure and biogenesis [J]	1.00
COG0424	7-methyl-GTP pyrophosphatase and related NTP pyrophosphatases, Maf/HAM1 superfamily	Secondary metabolites biosynthesis, transport and catabolism [Q]	1.00
COG0682	Prolipoprotein diacylglyceryltransferase	Cell wall/membrane/envelope biogenesis [M]	1.00
COG0751	Glycyl-tRNA synthetase, beta subunit	Translation, ribosomal structure and biogenesis [J]	1.00
COG0775	Nucleoside phosphorylase/nucleosidase, includes 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase MtnN and futalosine hydrolase MqnB	Nucleotide transport and metabolism [F]	1.00
COG0813	Purine-nucleoside phosphorylase	Nucleotide transport and metabolism [F]	1.00
COG1083	CMP-N-acetylneuraminic acid synthetase, NeuA/PseF family	Cell wall/membrane/envelope biogenesis [M]	1.00
COG1212	CMP-2-keto-3-deoxyoctulosonic acid synthetase	Cell wall/membrane/envelope biogenesis [M]	1.00
COG1259	Bifunctional DNase/RNase	General function prediction only [R]	1.00
COG1428	Deoxyadenosine/deoxycytidine kinase	Nucleotide transport and metabolism [F]	1.00
COG1861	Spore coat polysaccharide biosynthesis protein SpsF, cytidylyltransferase family	Cell wall/membrane/envelope biogenesis [M]	1.00
COG1866	Phosphoenolpyruvate carboxykinase, ATP-dependent	Energy production and conversion [C]	1.00
COG2217	Cation-transporting P-type ATPase	Inorganic ion transport and metabolism [P]	1.00
COG2608	Copper chaperone CopZ	Inorganic ion transport and metabolism [P]	1.00
COG2820	Uridine phosphorylase	Nucleotide transport and metabolism [F]	1.00
COG2825	Periplasmic chaperone for outer membrane proteins, Skp family	Cell wall/membrane/envelope biogenesis [M]	1.00
COG3039	Transposase and inactivated derivatives, IS5 family	Mobilome: prophages, transposons [X]	1.00
COG3293	Transposase	Mobilome: prophages, transposons [X]	1.00
COG3385	IS4 transposase InsG	Mobilome: prophages, transposons [X]	1.00
COG5421	Transposase	Mobilome: prophages, transposons [X]	1.00
COG5433	Predicted transposase YbfD/YdcC associated with H repeats	Mobilome: prophages, transposons [X]	1.00
COG5659	SRSO17 transposase	Mobilome: prophages, transposons [X]	1.00

NCBI Taxonomy

Select NCBI taxonomy Level:

Name	Rank	Taxonomy	Distribution
All Organisms	root	All Organisms	94.00 %
Unclassified	root	N/A	6.00 %

Name	Rank	Taxonomy	Distribution
cellular organisms	root	All Organisms → cellular organisms	94.00 %
Unclassified	root	N/A	6.00 %

Name	Rank	Taxonomy	Distribution
Bacteria	superkingdom	All Organisms → cellular organisms → Bacteria	94.00 %
Unclassified	root	N/A	6.00 %

Name	Rank	Taxonomy	Distribution
FCB group	clade	All Organisms → cellular organisms → Bacteria → FCB group	90.00 %
Unclassified	root	N/A	6.00 %
Terrabacteria group	clade	All Organisms → cellular organisms → Bacteria → Terrabacteria group	1.00 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes/Chlorobi group	clade	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group	89.00 %
Unclassified	root	N/A	6.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Name	Rank	Taxonomy	Distribution
Bacteroidetes	phylum	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	89.00 %
Unclassified	root	N/A	6.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Name	Rank	Taxonomy	Distribution
Bacteroidia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	50.00 %
Unclassified	root	N/A	6.00 %
Flavobacteriia	class	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia	1.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Name	Rank	Taxonomy	Distribution
Bacteroidales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	46.00 %
Unclassified	root	N/A	6.00 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Name	Rank	Taxonomy	Distribution
unclassified Bacteroidales	no rank	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales	23.00 %
Unclassified	root	N/A	6.00 %
Lentimicrobiaceae	family	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae	2.00 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Name	Rank	Taxonomy	Distribution
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	23.00 %
Unclassified	root	N/A	6.00 %
Lentimicrobium	genus	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium	2.00 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Name	Rank	Taxonomy	Distribution
Bacteroidales bacterium	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	23.00 %
Unclassified	root	N/A	6.00 %
Lentimicrobium saccharophilum	species	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum	2.00 %
Flavobacteriales	order	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1.00 %
Firmicutes	phylum	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	1.00 %

Visualization

Powered by ApexCharts

Associated Scaffolds

Scaffold	Taxonomy	Length	IMG/M Link
3300002168\|JGI24712J26585_10004023	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum	11378	Open in IMG/M
3300002168\|JGI24712J26585_10006392	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Lentimicrobiaceae → Lentimicrobium → Lentimicrobium saccharophilum	8436	Open in IMG/M
3300002168\|JGI24712J26585_10010569	All Organisms → cellular organisms → Bacteria	5926	Open in IMG/M
3300002168\|JGI24712J26585_10011111	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	5719	Open in IMG/M
3300002168\|JGI24712J26585_10013659	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	4926	Open in IMG/M
3300002168\|JGI24712J26585_10018448	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	3936	Open in IMG/M
3300002168\|JGI24712J26585_10027857	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2850	Open in IMG/M
3300002170\|JGI24711J26586_10003061	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	11405	Open in IMG/M
3300002170\|JGI24711J26586_10003068	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	11382	Open in IMG/M
3300002170\|JGI24711J26586_10003095	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	11311	Open in IMG/M
3300002170\|JGI24711J26586_10005044	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	8068	Open in IMG/M
3300002170\|JGI24711J26586_10005443	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	7637	Open in IMG/M
3300002170\|JGI24711J26586_10006391	All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes	6725	Open in IMG/M
3300002170\|JGI24711J26586_10012955	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	3922	Open in IMG/M
3300002173\|JGI24709J26583_10005866	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	8758	Open in IMG/M
3300002173\|JGI24709J26583_10009506	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	6194	Open in IMG/M
3300002173\|JGI24709J26583_10015226	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	4326	Open in IMG/M
3300002173\|JGI24709J26583_10015940	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4178	Open in IMG/M
3300002173\|JGI24709J26583_10022436	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3179	Open in IMG/M
3300002173\|JGI24709J26583_10025162	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2905	Open in IMG/M
3300002173\|JGI24709J26583_10034151	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2282	Open in IMG/M
3300002173\|JGI24709J26583_10034203	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2279	Open in IMG/M
3300002173\|JGI24709J26583_10081372	All Organisms → cellular organisms → Bacteria → FCB group	1118	Open in IMG/M
3300002173\|JGI24709J26583_10103714	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	911	Open in IMG/M
3300002174\|JGI24710J26742_10004038	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	12238	Open in IMG/M
3300002174\|JGI24710J26742_10011917	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	5734	Open in IMG/M
3300002174\|JGI24710J26742_10037631	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2316	Open in IMG/M
3300002174\|JGI24710J26742_10084222	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1176	Open in IMG/M
3300002174\|JGI24710J26742_10192818	Not Available	590	Open in IMG/M
3300002174\|JGI24710J26742_10217921	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	537	Open in IMG/M
3300002898\|draft_10021256	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	7433	Open in IMG/M
3300002898\|draft_10140420	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1549	Open in IMG/M
3300009655\|Ga0116190_1015292	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	4126	Open in IMG/M
3300009655\|Ga0116190_1045029	Not Available	1922	Open in IMG/M
3300009658\|Ga0116188_1019777	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3713	Open in IMG/M
3300009658\|Ga0116188_1027080	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2967	Open in IMG/M
3300009658\|Ga0116188_1033010	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2569	Open in IMG/M
3300009658\|Ga0116188_1043526	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2100	Open in IMG/M
3300009658\|Ga0116188_1067051	Not Available	1539	Open in IMG/M
3300009658\|Ga0116188_1092217	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1224	Open in IMG/M
3300009664\|Ga0116146_1026173	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	3051	Open in IMG/M
3300009664\|Ga0116146_1030628	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2737	Open in IMG/M
3300009664\|Ga0116146_1030881	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	2722	Open in IMG/M
3300009664\|Ga0116146_1076324	Not Available	1480	Open in IMG/M
3300009666\|Ga0116182_1015421	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	5379	Open in IMG/M
3300009666\|Ga0116182_1047588	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2453	Open in IMG/M
3300009666\|Ga0116182_1062377	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	2031	Open in IMG/M
3300009666\|Ga0116182_1072941	All Organisms → cellular organisms → Bacteria	1821	Open in IMG/M
3300009666\|Ga0116182_1093193	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1535	Open in IMG/M
3300009667\|Ga0116147_1002016	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	21379	Open in IMG/M
3300009667\|Ga0116147_1005172	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	11202	Open in IMG/M
3300009667\|Ga0116147_1029411	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2963	Open in IMG/M
3300009670\|Ga0116183_1019222	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4961	Open in IMG/M
3300009704\|Ga0116145_1184341	Not Available	816	Open in IMG/M
3300009714\|Ga0116189_1004601	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	9605	Open in IMG/M
3300009714\|Ga0116189_1016205	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	4293	Open in IMG/M
3300009714\|Ga0116189_1028096	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2912	Open in IMG/M
3300009714\|Ga0116189_1043542	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	2124	Open in IMG/M
3300009714\|Ga0116189_1047471	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1994	Open in IMG/M
3300009714\|Ga0116189_1076895	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1403	Open in IMG/M
3300009715\|Ga0116160_1149882	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	951	Open in IMG/M
3300009720\|Ga0116159_1027791	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	3266	Open in IMG/M
3300009720\|Ga0116159_1190147	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	846	Open in IMG/M
3300009767\|Ga0116161_1004329	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	12039	Open in IMG/M
3300010344\|Ga0116243_10002633	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	33064	Open in IMG/M
3300010344\|Ga0116243_10051188	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	3511	Open in IMG/M
3300010344\|Ga0116243_10076543	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	2606	Open in IMG/M
3300010347\|Ga0116238_10012929	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	9538	Open in IMG/M
3300010353\|Ga0116236_10720994	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	808	Open in IMG/M
3300010365\|Ga0116251_10005778	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	17136	Open in IMG/M
3300010365\|Ga0116251_10006041	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	16556	Open in IMG/M
3300010365\|Ga0116251_10016867	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	7409	Open in IMG/M
3300025613\|Ga0208461_1041759	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1584	Open in IMG/M
3300025629\|Ga0208824_1053534	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	1439	Open in IMG/M
3300025629\|Ga0208824_1129738	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	701	Open in IMG/M
3300025629\|Ga0208824_1132093	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	690	Open in IMG/M
3300025677\|Ga0209719_1128096	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	727	Open in IMG/M
3300025682\|Ga0209718_1074404	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1182	Open in IMG/M
3300025686\|Ga0209506_1070368	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1161	Open in IMG/M
3300025713\|Ga0208195_1011154	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	5395	Open in IMG/M
3300025713\|Ga0208195_1047424	All Organisms → cellular organisms → Bacteria	1822	Open in IMG/M
3300025713\|Ga0208195_1059703	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1539	Open in IMG/M
3300025737\|Ga0208694_1031103	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	2752	Open in IMG/M
3300025737\|Ga0208694_1041090	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia	2206	Open in IMG/M
3300025737\|Ga0208694_1079512	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1316	Open in IMG/M
3300026311\|Ga0209723_1287252	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	554	Open in IMG/M
(restricted) 3300028564\|Ga0255344_1001460	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	31704	Open in IMG/M
(restricted) 3300028564\|Ga0255344_1047715	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	2302	Open in IMG/M
(restricted) 3300028564\|Ga0255344_1073912	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales	1651	Open in IMG/M
(restricted) 3300028570\|Ga0255341_1006840	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	10483	Open in IMG/M
(restricted) 3300028570\|Ga0255341_1136374	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1070	Open in IMG/M
(restricted) 3300028576\|Ga0255340_1014842	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	5520	Open in IMG/M
(restricted) 3300028576\|Ga0255340_1059448	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	2040	Open in IMG/M
(restricted) 3300028576\|Ga0255340_1063486	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	1944	Open in IMG/M
(restricted) 3300028576\|Ga0255340_1088515	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1522	Open in IMG/M
(restricted) 3300028576\|Ga0255340_1244314	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	711	Open in IMG/M
(restricted) 3300028593\|Ga0255347_1013300	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes	7387	Open in IMG/M
(restricted) 3300028593\|Ga0255347_1163695	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → unclassified Bacteroidales → Bacteroidales bacterium	1090	Open in IMG/M
(restricted) 3300028677\|Ga0255346_1022297	All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales	4195	Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:

Habitat	Taxonomy	Distribution
Engineered	Engineered	100.00%

Habitat	Taxonomy	Distribution
Wastewater	Engineered → Wastewater	54.00%
Biotransformation	Engineered → Biotransformation	30.00%
Built Environment	Engineered → Built Environment	13.00%
Unclassified	Engineered → Unclassified	2.00%
Bioreactor	Engineered → Bioreactor	1.00%

Habitat	Taxonomy	Distribution
Anaerobic Digestor	Engineered → Wastewater → Anaerobic Digestor	54.00%
Mixed Alcohol Bioreactor	Engineered → Biotransformation → Mixed Alcohol Bioreactor	30.00%
Water Treatment Plant	Engineered → Built Environment → Water Treatment Plant	13.00%
Unclassified	Engineered → Unclassified → Unclassified	2.00%
Anaerobic	Engineered → Bioreactor → Anaerobic	1.00%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified	54.00%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified	30.00%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified	13.00%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified	2.00%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified	1.00%

Habitat	Taxonomy	Distribution
Unclassified	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified	54.00%
Unclassified	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified	30.00%
Unclassified	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified	13.00%
Unclassified	Engineered → Unclassified → Unclassified → Unclassified → Unclassified	2.00%
Unclassified	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified	1.00%

Habitat	Taxonomy	Distribution
Anaerobic Digestor Sludge	Engineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge	54.00%
Biogas Fermentantion	Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Biogas Fermentantion	30.00%
Wastewater	Engineered → Built Environment → Water Treatment Plant → Unclassified → Unclassified → Wastewater	13.00%
Biogas Fermenter	Engineered → Unclassified → Unclassified → Unclassified → Unclassified → Biogas Fermenter	2.00%
Anaerobic Biogas Reactor	Engineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Anaerobic Biogas Reactor	1.00%

Visualization

Powered by ApexCharts

Associated Samples

Taxon OID	Sample Name	Habitat Type	IMG/M Link
3300002168	Biogas fermentation microbial communities from Germany - Plant 3 DNA2	Engineered	Open in IMG/M
3300002170	Biogas fermentation microbial communities from Germany - Plant 3 DNA1	Engineered	Open in IMG/M
3300002173	Biogas fermentation microbial communities from Germany - Plant 2 DNA1	Engineered	Open in IMG/M
3300002174	Biogas fermentation microbial communities from Germany - Plant 2 DNA2	Engineered	Open in IMG/M
3300002898	Metagenome Biopara biogasfermenter May 2013 pooled	Engineered	Open in IMG/M
3300009655	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG	Engineered	Open in IMG/M
3300009658	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR2_MetaG	Engineered	Open in IMG/M
3300009664	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG	Engineered	Open in IMG/M
3300009666	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG	Engineered	Open in IMG/M
3300009667	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG3_MetaG	Engineered	Open in IMG/M
3300009670	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG	Engineered	Open in IMG/M
3300009704	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG1_MetaG	Engineered	Open in IMG/M
3300009714	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG	Engineered	Open in IMG/M
3300009715	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG	Engineered	Open in IMG/M
3300009720	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG	Engineered	Open in IMG/M
3300009767	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS3_MetaG	Engineered	Open in IMG/M
3300010344	AD_JPASca	Engineered	Open in IMG/M
3300010347	AD_JPHGca	Engineered	Open in IMG/M
3300010353	AD_USCAca	Engineered	Open in IMG/M
3300010365	AD_USDIca	Engineered	Open in IMG/M
3300025613	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR4_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025629	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNTR3_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025677	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025682	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNAS1_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025686	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHG2_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025713	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC077_MetaG (SPAdes)	Engineered	Open in IMG/M
3300025737	Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC078_MetaG (SPAdes)	Engineered	Open in IMG/M
3300026311	Anaerobic biogas reactor microbial communites from Washington, USA - Biogas_R2 time_0 SIP DNA (SPAdes)	Engineered	Open in IMG/M
3300028564 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant18	Engineered	Open in IMG/M
3300028570 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant12	Engineered	Open in IMG/M
3300028576 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant10	Engineered	Open in IMG/M
3300028593 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant24	Engineered	Open in IMG/M
3300028677 (restricted)	Wastewater microbial communities from Lulu Island WWTP, Vancouver, Canada - plant22	Engineered	Open in IMG/M

Geographical Distribution

Zoom:	Powered by OpenStreetMap

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID	Sample Taxon ID	Habitat	Sequence
JGI24712J26585_1000402310	3300002168	Biogas Fermentantion	VSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY*
JGI24712J26585_1000639210	3300002168	Biogas Fermentantion	PMGTRRQKSELVSSFCRLASPRLVPXDLEPGADPERSEGARPNKK*
JGI24712J26585_100105691	3300002168	Biogas Fermentantion	LVSSFCRLATPRLVPADLEPGADPERSEGARPNNFYII*
JGI24712J26585_100111115	3300002168	Biogas Fermentantion	QKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKNKK*
JGI24712J26585_100136597	3300002168	Biogas Fermentantion	QKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI*
JGI24712J26585_100184485	3300002168	Biogas Fermentantion	QKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPNKK*
JGI24712J26585_100278571	3300002168	Biogas Fermentantion	QKSELVSSFCRLASPRLVPADLXPGADPERSEGARPNXK*
JGI24711J26586_100030611	3300002170	Biogas Fermentantion	SELVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY*
JGI24711J26586_100030681	3300002170	Biogas Fermentantion	QKSELVSSFCRLASPRLVPADLQPGADPERSEGTRPKNHHP*
JGI24711J26586_1000309511	3300002170	Biogas Fermentantion	SELVSSFCRLASPRLVPEDLEPGADPERSEGARPNKK*
JGI24711J26586_100050441	3300002170	Biogas Fermentantion	QKSELVSSFCRLASPRLVPADLQPGADPERSEGARPNKK*
JGI24711J26586_1000544311	3300002170	Biogas Fermentantion	QKSELVSSFCRFASPRLVPADLEPGADPERSEGARPKEN*
JGI24711J26586_100063911	3300002170	Biogas Fermentantion	QKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
JGI24711J26586_100129551	3300002170	Biogas Fermentantion	LVSSFCRLASPRLVPADLEPGADPERSEGTRPNKK*
JGI24709J26583_1000586613	3300002173	Biogas Fermentantion	KSELVSSFCRFASPRLVPADLEPGADPERSEGAHPNKKN*
JGI24709J26583_100095061	3300002173	Biogas Fermentantion	KPMGTRRQKSELVSSFCRLASPRLVPEDLEPGADPERSEGARPNKK*
JGI24709J26583_100152261	3300002173	Biogas Fermentantion	KSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKLNYFYCTKNRN*
JGI24709J26583_100159401	3300002173	Biogas Fermentantion	GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPN*
JGI24709J26583_100224361	3300002173	Biogas Fermentantion	RQKSELVSSFCRFATPRLATEDLEPKTDPERSEGTRPNKKIKLFLS*
JGI24709J26583_100251621	3300002173	Biogas Fermentantion	SELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKNKK*
JGI24709J26583_100341511	3300002173	Biogas Fermentantion	LVSSFCRLATPRLATADLEPGADPERSEGTRPNNKYN*
JGI24709J26583_100342031	3300002173	Biogas Fermentantion	KSELVSSFCRFASPRLVPADLEPGADPERSEGARPKEN*
JGI24709J26583_100813721	3300002173	Biogas Fermentantion	KSELVSSFCRFASPRLPPADLEPKTDPERSEGTRPKYKYR*
JGI24709J26583_101037142	3300002173	Biogas Fermentantion	ELVSSFCRLASPRLVPADLQPKTDPERSEGARPKKNYSY*
JGI24710J26742_1000403816	3300002174	Biogas Fermentantion	VSSFCRLASPRLATADLEPKTDPERSEGARPNKN*
JGI24710J26742_100119171	3300002174	Biogas Fermentantion	GTRRQKSELVSSFCRFATPRLVPADLEPGADPERSEGTRPNKN*
JGI24710J26742_100376311	3300002174	Biogas Fermentantion	QKSELVSSFCRFASPRLVPADLEPGADPERSEGTRPNNNYN*
JGI24710J26742_100842221	3300002174	Biogas Fermentantion	KSELVSSFCRLASPRLVPADLEPGADPEHSEGARPN*
JGI24710J26742_101928182	3300002174	Biogas Fermentantion	LGTRRQKSELVSSFCRLASPRLVPADLEPETDPERSEGARPNKN*
JGI24710J26742_102179211	3300002174	Biogas Fermentantion	QKSELVSSFCRLATPRLVPADLEPGADPERSEGARPN*
draft_100212569	3300002898	Biogas Fermenter	RRQKSELVSSFCRLASPRLATADLEPDADPERSEGTRPKKKYLYD*
draft_101404203	3300002898	Biogas Fermenter	RRQKSELVSSFCRLATPRLVPADLEPETDPERSEGARPNKK*
Ga0116190_10152925	3300009655	Anaerobic Digestor Sludge	RQKSELVSSFCRLASPRLATADLEPGADPERSEGARPKKYYLYN*
Ga0116190_10450292	3300009655	Anaerobic Digestor Sludge	LGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK*
Ga0116188_10197776	3300009658	Anaerobic Digestor Sludge	RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI*
Ga0116188_10270803	3300009658	Anaerobic Digestor Sludge	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
Ga0116188_10330103	3300009658	Anaerobic Digestor Sludge	RRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKNNKK*
Ga0116188_10435263	3300009658	Anaerobic Digestor Sludge	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK*
Ga0116188_10670512	3300009658	Anaerobic Digestor Sludge	RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK*
Ga0116188_10922172	3300009658	Anaerobic Digestor Sludge	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN*
Ga0116146_10261733	3300009664	Anaerobic Digestor Sludge	TRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
Ga0116146_10306281	3300009664	Anaerobic Digestor Sludge	GTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPDKN*
Ga0116146_10308811	3300009664	Anaerobic Digestor Sludge	TRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK*
Ga0116146_10763241	3300009664	Anaerobic Digestor Sludge	QRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPNKKYN*
Ga0116182_10154215	3300009666	Anaerobic Digestor Sludge	ELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK*
Ga0116182_10475881	3300009666	Anaerobic Digestor Sludge	SELVSSFCRFATPRLAAADLQAKTDPERSEGARPNKK*
Ga0116182_10623774	3300009666	Anaerobic Digestor Sludge	GTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGTRPKKK*
Ga0116182_10729413	3300009666	Anaerobic Digestor Sludge	GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK*
Ga0116182_10931931	3300009666	Anaerobic Digestor Sludge	QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN*
Ga0116147_10020161	3300009667	Anaerobic Digestor Sludge	GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNK*
Ga0116147_10051721	3300009667	Anaerobic Digestor Sludge	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN*
Ga0116147_10074612	3300009667	Anaerobic Digestor Sludge	KPLGTRRQKSELVSSFRRFATPRLVPADLEPGADPERSEGARPN*
Ga0116147_10294115	3300009667	Anaerobic Digestor Sludge	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK*
Ga0116183_10192221	3300009670	Anaerobic Digestor Sludge	SELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK*
Ga0116145_11843413	3300009704	Anaerobic Digestor Sludge	LGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGARPNKKYN*
Ga0116189_10046011	3300009714	Anaerobic Digestor Sludge	LGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK*
Ga0116189_10162053	3300009714	Anaerobic Digestor Sludge	RRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNNFYII*
Ga0116189_10280961	3300009714	Anaerobic Digestor Sludge	SELVSSFCRLASPRLVPADLEPGADPERSEGARPKKNKNR*
Ga0116189_10435423	3300009714	Anaerobic Digestor Sludge	RQKSELVSSFCRLASPRLATADLEPGADPERSEGTRPNNKYN*
Ga0116189_10474711	3300009714	Anaerobic Digestor Sludge	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN*
Ga0116189_10768951	3300009714	Anaerobic Digestor Sludge	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN*
Ga0116160_11498823	3300009715	Anaerobic Digestor Sludge	QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI*
Ga0116159_10277911	3300009720	Anaerobic Digestor Sludge	QKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN*
Ga0116159_11901471	3300009720	Anaerobic Digestor Sludge	SELVSSFCRLATPRLVPADLEPGADPERSEGTRPDKY*
Ga0116161_100432915	3300009767	Anaerobic Digestor Sludge	GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK*
Ga0116243_1000263332	3300010344	Anaerobic Digestor Sludge	GTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI*
Ga0116243_100511883	3300010344	Anaerobic Digestor Sludge	RRQKSELVSSFCRFATPRLVPADLEPGADPERSEGTRPKENYDYYF*
Ga0116243_100765432	3300010344	Anaerobic Digestor Sludge	RQKSELVSSFRRFATPRLVPADLEPGADPERSEGARPN*
Ga0116238_100129297	3300010347	Anaerobic Digestor Sludge	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK*
Ga0116236_107209941	3300010353	Anaerobic Digestor Sludge	SELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI*
Ga0116251_100057781	3300010365	Anaerobic Digestor Sludge	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK*
Ga0116251_1000604114	3300010365	Anaerobic Digestor Sludge	RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN*
Ga0116251_100168676	3300010365	Anaerobic Digestor Sludge	PMGTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN*
Ga0208461_10417591	3300025613	Anaerobic Digestor Sludge	RQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN
Ga0208824_10535344	3300025629	Anaerobic Digestor Sludge	SELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI
Ga0208824_11297381	3300025629	Anaerobic Digestor Sludge	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEN
Ga0208824_11320932	3300025629	Anaerobic Digestor Sludge	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKN
Ga0209719_11280961	3300025677	Anaerobic Digestor Sludge	QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKKYNYI
Ga0209718_10744042	3300025682	Anaerobic Digestor Sludge	ELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK
Ga0209506_10703683	3300025686	Anaerobic Digestor Sludge	TRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKK
Ga0208195_10111541	3300025713	Anaerobic Digestor Sludge	RRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK
Ga0208195_10474241	3300025713	Anaerobic Digestor Sludge	GTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
Ga0208195_10597031	3300025713	Anaerobic Digestor Sludge	RQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN
Ga0208694_10311033	3300025737	Anaerobic Digestor Sludge	KSELVSSFCRLASPRLVPADLEPGADPERSEGTRPNLKTNYY
Ga0208694_10410903	3300025737	Anaerobic Digestor Sludge	ELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK
Ga0208694_10795121	3300025737	Anaerobic Digestor Sludge	LVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
Ga0209723_12872521	3300026311	Anaerobic Biogas Reactor	MGTQRQKSELVSSFCRFASPRLVPADLEPGADPERSEGAH
(restricted) Ga0255344_10014601	3300028564	Wastewater	TRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255344_10477151	3300028564	Wastewater	PLGTRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPKEK
(restricted) Ga0255344_10739123	3300028564	Wastewater	QKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNIKTNY
(restricted) Ga0255341_100684015	3300028570	Wastewater	KSELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
(restricted) Ga0255341_11363743	3300028570	Wastewater	SRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255340_10148421	3300028576	Wastewater	RRQKSELVSSFCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI
(restricted) Ga0255340_10594481	3300028576	Wastewater	SELVSSFCRHATPRLVPADLEPGADPERSEGARPNKN
(restricted) Ga0255340_10634863	3300028576	Wastewater	RRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255340_10885151	3300028576	Wastewater	KPQGSRRQKSELVSSFCRLATPRLVPADLEPGADPERSEGARPNKK
(restricted) Ga0255340_12443141	3300028576	Wastewater	QKSELVSSFCRLATPRLVPADLEPGADPERSEGARPDKK
(restricted) Ga0255347_10133005	3300028593	Wastewater	GTRRQKSELVSSFCRLASPRLVPADLEPGADPERSEGARPNKN
(restricted) Ga0255347_11636951	3300028593	Wastewater	ELVSSFCRLATPRLVPADLEPGADPERSEGARPNNK
(restricted) Ga0255346_10222977	3300028677	Wastewater	FCRLATPRLVPADLEPGADPERSEGTRPNKKYNYI

Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters