Basic Information | |
---|---|
Family ID | F104271 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 41 residues |
Representative Sequence | LVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVAGFEFVSD |
Number of Associated Samples | 66 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Unclassified |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 98.00 % |
% of genes from short scaffolds (< 2000 bps) | 96.00 % |
Associated GOLD sequencing projects | 65 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.32 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Unclassified (90.000 % of family members) |
NCBI Taxonomy ID | N/A |
Taxonomy | N/A |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere (77.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (92.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant surface (87.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 36.76% β-sheet: 0.00% Coil/Unstructured: 63.24% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.32 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF07727 | RVT_2 | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
Unclassified | root | N/A | 90.00 % |
All Organisms | root | All Organisms | 10.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300005618|Ga0068864_101199383 | Not Available | 757 | Open in IMG/M |
3300005841|Ga0068863_101780737 | Not Available | 626 | Open in IMG/M |
3300005841|Ga0068863_101817246 | Not Available | 619 | Open in IMG/M |
3300009553|Ga0105249_10833658 | Not Available | 987 | Open in IMG/M |
3300009553|Ga0105249_12571371 | Not Available | 581 | Open in IMG/M |
3300009975|Ga0105129_117435 | Not Available | 541 | Open in IMG/M |
3300009980|Ga0105135_112192 | Not Available | 677 | Open in IMG/M |
3300014486|Ga0182004_10147521 | Not Available | 892 | Open in IMG/M |
3300014968|Ga0157379_11124789 | Not Available | 753 | Open in IMG/M |
3300015278|Ga0182099_1002781 | Not Available | 1185 | Open in IMG/M |
3300015280|Ga0182100_1045758 | Not Available | 658 | Open in IMG/M |
3300015290|Ga0182105_1089150 | Not Available | 541 | Open in IMG/M |
3300015293|Ga0182103_1028338 | Not Available | 757 | Open in IMG/M |
3300015297|Ga0182104_1079685 | Not Available | 586 | Open in IMG/M |
3300015301|Ga0182184_1102464 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum miliaceum | 500 | Open in IMG/M |
3300015310|Ga0182162_1027671 | Not Available | 861 | Open in IMG/M |
3300015311|Ga0182182_1085309 | Not Available | 574 | Open in IMG/M |
3300015313|Ga0182164_1041149 | Not Available | 782 | Open in IMG/M |
3300015316|Ga0182121_1044926 | Not Available | 793 | Open in IMG/M |
3300015317|Ga0182136_1117879 | Not Available | 540 | Open in IMG/M |
3300015319|Ga0182130_1016947 | Not Available | 1007 | Open in IMG/M |
3300015319|Ga0182130_1124347 | Not Available | 522 | Open in IMG/M |
3300015320|Ga0182165_1023385 | Not Available | 977 | Open in IMG/M |
3300015320|Ga0182165_1045700 | Not Available | 781 | Open in IMG/M |
3300015324|Ga0182134_1041982 | Not Available | 802 | Open in IMG/M |
3300015324|Ga0182134_1070715 | Not Available | 669 | Open in IMG/M |
3300015325|Ga0182148_1053506 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Arundinoideae → Arundineae → Arundo → Arundo donax | 727 | Open in IMG/M |
3300015326|Ga0182166_1033756 | Not Available | 843 | Open in IMG/M |
3300015326|Ga0182166_1097432 | Not Available | 587 | Open in IMG/M |
3300015329|Ga0182135_1023086 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 990 | Open in IMG/M |
3300015329|Ga0182135_1080061 | Not Available | 651 | Open in IMG/M |
3300015330|Ga0182152_1114643 | Not Available | 568 | Open in IMG/M |
3300015332|Ga0182117_1069835 | Not Available | 728 | Open in IMG/M |
3300015333|Ga0182147_1075670 | Not Available | 697 | Open in IMG/M |
3300015333|Ga0182147_1085932 | Not Available | 664 | Open in IMG/M |
3300015334|Ga0182132_1070209 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 719 | Open in IMG/M |
3300015334|Ga0182132_1164153 | Not Available | 509 | Open in IMG/M |
3300015335|Ga0182116_1147025 | Not Available | 550 | Open in IMG/M |
3300015336|Ga0182150_1033198 | Not Available | 912 | Open in IMG/M |
3300015336|Ga0182150_1100904 | Not Available | 616 | Open in IMG/M |
3300015337|Ga0182151_1045653 | Not Available | 820 | Open in IMG/M |
3300015337|Ga0182151_1114090 | Not Available | 587 | Open in IMG/M |
3300015338|Ga0182137_1059067 | Not Available | 794 | Open in IMG/M |
3300015338|Ga0182137_1142786 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta | 555 | Open in IMG/M |
3300015339|Ga0182149_1004772 | Not Available | 1663 | Open in IMG/M |
3300015339|Ga0182149_1109828 | Not Available | 610 | Open in IMG/M |
3300015340|Ga0182133_1170430 | Not Available | 530 | Open in IMG/M |
3300015348|Ga0182115_1185722 | Not Available | 666 | Open in IMG/M |
3300015348|Ga0182115_1185956 | Not Available | 666 | Open in IMG/M |
3300015348|Ga0182115_1237011 | Not Available | 582 | Open in IMG/M |
3300015349|Ga0182185_1002918 | Not Available | 2595 | Open in IMG/M |
3300015349|Ga0182185_1096463 | Not Available | 845 | Open in IMG/M |
3300015349|Ga0182185_1099675 | Not Available | 833 | Open in IMG/M |
3300015349|Ga0182185_1217378 | Not Available | 580 | Open in IMG/M |
3300015350|Ga0182163_1177593 | Not Available | 666 | Open in IMG/M |
3300015350|Ga0182163_1257682 | Not Available | 547 | Open in IMG/M |
3300015350|Ga0182163_1259906 | Not Available | 544 | Open in IMG/M |
3300015352|Ga0182169_1153962 | Not Available | 750 | Open in IMG/M |
3300015352|Ga0182169_1178130 | Not Available | 695 | Open in IMG/M |
3300015352|Ga0182169_1260368 | Not Available | 563 | Open in IMG/M |
3300015353|Ga0182179_1241903 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae | 581 | Open in IMG/M |
3300015353|Ga0182179_1296898 | Not Available | 525 | Open in IMG/M |
3300015354|Ga0182167_1044306 | Not Available | 1501 | Open in IMG/M |
3300015354|Ga0182167_1083840 | Not Available | 1151 | Open in IMG/M |
3300015354|Ga0182167_1117368 | Not Available | 978 | Open in IMG/M |
3300015354|Ga0182167_1163479 | Not Available | 820 | Open in IMG/M |
3300015354|Ga0182167_1198219 | Not Available | 735 | Open in IMG/M |
3300015354|Ga0182167_1332636 | Not Available | 534 | Open in IMG/M |
3300017408|Ga0182197_1018348 | Not Available | 1103 | Open in IMG/M |
3300017412|Ga0182199_1055939 | Not Available | 821 | Open in IMG/M |
3300017412|Ga0182199_1103706 | Not Available | 657 | Open in IMG/M |
3300017414|Ga0182195_1049653 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Panicodae → Paniceae → Panicinae → Panicum → Panicum sect. Hiantes → Panicum virgatum | 888 | Open in IMG/M |
3300017422|Ga0182201_1028186 | Not Available | 866 | Open in IMG/M |
3300017424|Ga0182219_1040697 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae → commelinids → Poales → Poaceae → PACMAD clade → Panicoideae → Andropogonodae → Andropogoneae → Saccharinae → Saccharum → Saccharum officinarum complex → Saccharum officinarum | 738 | Open in IMG/M |
3300017435|Ga0182194_1111881 | Not Available | 568 | Open in IMG/M |
3300017439|Ga0182200_1009494 | Not Available | 1294 | Open in IMG/M |
3300017439|Ga0182200_1089986 | Not Available | 622 | Open in IMG/M |
3300017439|Ga0182200_1104111 | Not Available | 591 | Open in IMG/M |
3300017446|Ga0182217_1065378 | Not Available | 847 | Open in IMG/M |
3300017447|Ga0182215_1146733 | Not Available | 543 | Open in IMG/M |
3300017693|Ga0182216_1032769 | Not Available | 1036 | Open in IMG/M |
3300026095|Ga0207676_11332912 | Not Available | 713 | Open in IMG/M |
3300028049|Ga0268322_1004990 | Not Available | 1042 | Open in IMG/M |
3300028057|Ga0268352_1016173 | Not Available | 776 | Open in IMG/M |
3300028153|Ga0268320_1026372 | Not Available | 525 | Open in IMG/M |
3300028153|Ga0268320_1030183 | Not Available | 503 | Open in IMG/M |
3300028154|Ga0268341_1005539 | Not Available | 850 | Open in IMG/M |
3300028253|Ga0268316_1003018 | Not Available | 923 | Open in IMG/M |
3300028381|Ga0268264_10109264 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Chitinophagia → Chitinophagales → Chitinophagaceae → Ferruginibacter → unclassified Ferruginibacter → Ferruginibacter sp. HRS2-29 | 2419 | Open in IMG/M |
3300028464|Ga0268302_103357 | Not Available | 692 | Open in IMG/M |
3300028472|Ga0268315_1011598 | All Organisms → cellular organisms → Eukaryota → Viridiplantae → Streptophyta → Streptophytina → Embryophyta → Tracheophyta → Euphyllophyta → Spermatophyta → Magnoliopsida → Mesangiospermae → Liliopsida → Petrosaviidae | 658 | Open in IMG/M |
3300028473|Ga0268319_1015962 | Not Available | 574 | Open in IMG/M |
3300028525|Ga0268305_103126 | Not Available | 763 | Open in IMG/M |
3300028529|Ga0268311_1005719 | Not Available | 831 | Open in IMG/M |
3300032465|Ga0214493_1130582 | Not Available | 588 | Open in IMG/M |
3300032916|Ga0314734_1061657 | Not Available | 756 | Open in IMG/M |
3300032934|Ga0314741_1042872 | Not Available | 1038 | Open in IMG/M |
3300033535|Ga0314759_1202035 | Not Available | 632 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Switchgrass Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Switchgrass Phyllosphere | 77.00% |
Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Phyllosphere | 11.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 5.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 2.00% |
Switchgrass Associated | Host-Associated → Plants → Unclassified → Unclassified → Unclassified → Switchgrass Associated | 2.00% |
Root | Host-Associated → Plants → Roots → Unclassified → Unclassified → Root | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Phyllosphere | Host-Associated → Plants → Phyllosphere → Unclassified → Unclassified → Miscanthus Phyllosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Host-Associated | Open in IMG/M |
3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009975 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_187 metaG | Host-Associated | Open in IMG/M |
3300009980 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - LS_219 metaG | Host-Associated | Open in IMG/M |
3300014486 | Endophyte microbial communities from Sorghum bicolor roots, Mead, Nebraska, USA - 072115-40_1 MetaG | Host-Associated | Open in IMG/M |
3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Host-Associated | Open in IMG/M |
3300015278 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015280 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015290 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015293 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015297 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_09MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015301 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015310 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015311 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015313 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015316 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015317 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015319 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015320 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015324 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015325 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015326 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015329 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015330 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015332 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015333 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015334 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015335 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015336 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015337 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015338 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015339 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12JUL2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015340 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_20JUN2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015348 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_31MAY2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015349 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015350 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015352 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015353 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_22AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300015354 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_01AUG2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017408 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017412 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017414 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017422 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017424 | Miscanthus phyllosphere microbial communities from Michigan, USA - G6R2_MAIN_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017435 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_MAIN_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017439 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_12SEP2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017446 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017447 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R2_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300017693 | Switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_NF_03OCT2016_LD1 MG | Host-Associated | Open in IMG/M |
3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028049 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028057 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_18SEP2017_LD1 | Host-Associated | Open in IMG/M |
3300028153 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_NF_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028154 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_MAIN_28AUG2017_LD1 | Host-Associated | Open in IMG/M |
3300028253 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R1_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300028464 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R3_MAIN_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028472 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_NF_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028473 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_26JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300028525 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R2_NF_15MAY2017_LD1 | Host-Associated | Open in IMG/M |
3300028529 | Phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_05JUN2017_LD1 | Host-Associated | Open in IMG/M |
3300032465 | Metatranscriptome of phyllosphere microbial comminities from switchgrass, GLBRC, Michigan, United States - G5R4_MAIN_12JUL2016_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032916 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R4_MAIN_26JUN2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300032934 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R3_MAIN_17JUL2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
3300033535 | Metatranscriptome of switchgrass phyllosphere microbial communities from Michigan, USA - G5R1_NF_28AUG2017_LR1 (Metagenome Metatranscriptome) | Host-Associated | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
Ga0068864_1011993831 | 3300005618 | Switchgrass Rhizosphere | VFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0068863_1017807371 | 3300005841 | Switchgrass Rhizosphere | LAGKAFSARSIKLCLVDNQRSIGLMIAGLRIMSD* |
Ga0068863_1018172462 | 3300005841 | Switchgrass Rhizosphere | FLLVFFDSLVEKVFLASSIKSCLVDNQWSYVVTIAGLGIVSD* |
Ga0105249_108336581 | 3300009553 | Switchgrass Rhizosphere | FLLVFFDSLAGKAFSARSIKLCLVDNQWSGGVTVAGFEFVYD* |
Ga0105249_125713711 | 3300009553 | Switchgrass Rhizosphere | LVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0105129_1174351 | 3300009975 | Switchgrass Associated | LAGKAFLARSFKLCLVDNQRSCGVTVAGFEFVSD* |
Ga0105135_1121921 | 3300009980 | Switchgrass Associated | IIRLRIYIVLLVSFDSLVGKAFSARSITLCLVDNQRSGGVTVAGFEFVFD* |
Ga0182004_101475211 | 3300014486 | Root | LVFLDLLAGTTFLARLIKLCLVDNQRSSGVTVAGFESC* |
Ga0157379_111247891 | 3300014968 | Switchgrass Rhizosphere | DCVVYIFLLVFFDSLAGKAFSVRSIKLCLVDNQWSSGVTVA* |
Ga0182099_10027811 | 3300015278 | Switchgrass Phyllosphere | PFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0182100_10457581 | 3300015280 | Switchgrass Phyllosphere | VFFDSLAGKAFLARSIELCSVDNQQSSSVMVAGLQIISD* |
Ga0182105_10891502 | 3300015290 | Switchgrass Phyllosphere | RVYIFLLVSFDSLAGKAFSARSIKLFLVDNQRSSGVAVAGFESC* |
Ga0182103_10283381 | 3300015293 | Switchgrass Phyllosphere | FDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFMSD* |
Ga0182104_10796851 | 3300015297 | Switchgrass Phyllosphere | GSFAGKAFSARSIKLCLVDNQRSSGVTIAGFEFVFD* |
Ga0182184_10150422 | 3300015301 | Switchgrass Phyllosphere | CNFRLRVYPFLLVFFDSLARKAFSARSIKLCLVDNQRSGGVTVAGFEFISD* |
Ga0182184_11024642 | 3300015301 | Switchgrass Phyllosphere | VYIFLLVFFDSLAGKAFSARSIKLCLVDNQQSSGVTVA* |
Ga0182162_10276711 | 3300015310 | Switchgrass Phyllosphere | LLVFFDFLAGKAFFVRLIELCLVDNQWSNGVTVVGVQIVF |
Ga0182182_10853092 | 3300015311 | Switchgrass Phyllosphere | LLVFFDSLAGKAFLARSIKLFLVDNQWSGGVTVAGFEFVSD* |
Ga0182164_10411492 | 3300015313 | Switchgrass Phyllosphere | VYIFLLVSFDSLAGKAFLARSIKLCLVDNERSNGVAVAGFESC* |
Ga0182121_10449262 | 3300015316 | Switchgrass Phyllosphere | VFFDLRAGKAFLATSIKLCLVDNQRCGGITVAGFEFVSD* |
Ga0182136_10768351 | 3300015317 | Switchgrass Phyllosphere | IYNFRLCVYPFLLVFFDFLAGKAFFVRLIELCLVDNQWSSGVTVVGVQIVSD* |
Ga0182136_11178791 | 3300015317 | Switchgrass Phyllosphere | ILRVYIFLLVSFDSLVGKAFSARSIKLSFVDNQRSSGVAVAGFESC* |
Ga0182130_10169471 | 3300015319 | Switchgrass Phyllosphere | YPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD* |
Ga0182130_11243471 | 3300015319 | Switchgrass Phyllosphere | LVFFDSLARKAFLARSIKLCLVDNQRSGGVTVAGFEFMSD* |
Ga0182165_10233851 | 3300015320 | Switchgrass Phyllosphere | LLVFFDSLVGKTFLARSIKLCLVDNQRSTGVMVAGFESCLI* |
Ga0182165_10457001 | 3300015320 | Switchgrass Phyllosphere | FDSLAGKAFLARSIKLCLVDKQWSSGVTVAGLRIMSD* |
Ga0182134_10419821 | 3300015324 | Switchgrass Phyllosphere | YPFLLVFFDSLAGKAFLARSIKLCLVDNQWSSGVTVAGL* |
Ga0182134_10707151 | 3300015324 | Switchgrass Phyllosphere | VYSFLLVFFDSVAGKTFLARLIKLYLIDNQWNSGVMVAGLRIVSD* |
Ga0182148_10535061 | 3300015325 | Switchgrass Phyllosphere | LLVFFDSLAGKAFLERSIKLCLVDNQWSGGVMVAGFEF |
Ga0182166_10337562 | 3300015326 | Switchgrass Phyllosphere | FAEKDFSARSIKLCLVDNQRSNDVTVAVLRIVYD* |
Ga0182166_10974321 | 3300015326 | Switchgrass Phyllosphere | LVFFDSLAEKAFLARSIKLCLVDNQWSGGVMVAGFEFMSD* |
Ga0182135_10230862 | 3300015329 | Switchgrass Phyllosphere | VYIFLLVSFDSLAGKAFLARSIKLCLVDNQRSSGVALAVFESS* |
Ga0182135_10800611 | 3300015329 | Switchgrass Phyllosphere | FLLVFFDSLVGKAFSARSIKMCLVDNQRSSGVTVA* |
Ga0182152_11146431 | 3300015330 | Switchgrass Phyllosphere | FLLVFFDSLAGKAFLARSIKLCLVDNQWSGGVTVAGFELVSD* |
Ga0182117_10698351 | 3300015332 | Switchgrass Phyllosphere | SFILAIIRLCVYPFLLVFFDSLVEKAFLARSIKLCLVDNQRSSGVAVAGFESC* |
Ga0182147_10756701 | 3300015333 | Switchgrass Phyllosphere | TFLLVFFDSLAGKVFSVRSIKLCLVDNQWSSGVTVAGLRIVSD* |
Ga0182147_10859322 | 3300015333 | Switchgrass Phyllosphere | FDSLARKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0182132_10702091 | 3300015334 | Switchgrass Phyllosphere | FDSLAGKAFSVRSIKLCLVDNQRSGGVTVAGFEFVFD* |
Ga0182132_11641531 | 3300015334 | Switchgrass Phyllosphere | NLLAEKVFLARSIKLCLVDNQRSSGVTVAGLRIVSD* |
Ga0182116_11470251 | 3300015335 | Switchgrass Phyllosphere | LVGKAFLARSIKLCLVDNQRSSGVTVAGLRIVSD* |
Ga0182150_10331981 | 3300015336 | Switchgrass Phyllosphere | RLRVYPFLLVFFDSLAGKAFSARSIKLCLVDNQWSSGVAVVGFESC* |
Ga0182150_11009041 | 3300015336 | Switchgrass Phyllosphere | SLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0182151_10456532 | 3300015337 | Switchgrass Phyllosphere | FFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0182151_11140901 | 3300015337 | Switchgrass Phyllosphere | LRVYPFLLVFFDSLARKAFSARSIKLCLVDNQRSGGVTVAGFEFVSY* |
Ga0182137_10590671 | 3300015338 | Switchgrass Phyllosphere | VSFDSLAGKAFSARSIKLCLVDNQRNSGVAVAGFESC* |
Ga0182137_11427862 | 3300015338 | Switchgrass Phyllosphere | NSLAGKAFLARSIKLCLVDNQRSSGVAVTGFESC* |
Ga0182149_10047721 | 3300015339 | Switchgrass Phyllosphere | IFLLVSFDSLAEKVFSARSIKLCLVDNQQSSGVAVAGFESC* |
Ga0182149_11098282 | 3300015339 | Switchgrass Phyllosphere | FLLVSFDLLAEKAFSARSIKLCLVDNQRSSGVAVAGFESC* |
Ga0182133_11704301 | 3300015340 | Switchgrass Phyllosphere | FNLLVGKAFSTRSIKLCLVDNQRSSGVAVAGFELR* |
Ga0182115_11857222 | 3300015348 | Switchgrass Phyllosphere | VFFDSLAGKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD* |
Ga0182115_11859561 | 3300015348 | Switchgrass Phyllosphere | LLVFFDSLAGKAFSARSIKLCLVDNQRSCGVMVA* |
Ga0182115_12370111 | 3300015348 | Switchgrass Phyllosphere | VFFDSLAGKAFLTRSIKLCLVDNQQSSGVTVAGH* |
Ga0182185_10029181 | 3300015349 | Switchgrass Phyllosphere | NFRLCVYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD* |
Ga0182185_10964632 | 3300015349 | Switchgrass Phyllosphere | FFDSLAGKAFLARTIKLCLVDNQQSSDVTVVGLRIVSD* |
Ga0182185_10996752 | 3300015349 | Switchgrass Phyllosphere | FLLVFFDSLAGKAFLARSIKLCLVDNQRSSGVMVASFEFVSD* |
Ga0182185_12173781 | 3300015349 | Switchgrass Phyllosphere | VYTFLLVFFDSLAGKAFLVRSIKLCLVGNQQSSGVTIVGFEFVSD* |
Ga0182163_11775931 | 3300015350 | Switchgrass Phyllosphere | MSFDSLAGKAFSARSTNLCLVDNQRSSGVVVAGFESC* |
Ga0182163_12576821 | 3300015350 | Switchgrass Phyllosphere | VYPLLLMFFDSLARKAFLVRLVKLCLVDNQWSSGVTVA* |
Ga0182163_12599061 | 3300015350 | Switchgrass Phyllosphere | FDSLVGKAFLARSIKLCLVDNQRSSGVTVAELQIVFD* |
Ga0182169_11539621 | 3300015352 | Switchgrass Phyllosphere | LAGKAFLARSIKLYLVDNQWSGGVTVAGFEFVSD* |
Ga0182169_11781301 | 3300015352 | Switchgrass Phyllosphere | CVYIFLLVFFDSLAGKAFSAMSIKLCMVDNQRSSGVTVA* |
Ga0182169_12603681 | 3300015352 | Switchgrass Phyllosphere | FLLVFFDSLAGKAFSARSIKLCLVDNQRSSGVAVAGFESC* |
Ga0182179_12419031 | 3300015353 | Switchgrass Phyllosphere | LVFFDSLAGKAFLVRSIKLCLIDNQRSGGVMVAGFEFMSD* |
Ga0182179_12968982 | 3300015353 | Switchgrass Phyllosphere | VSFDSLAGKAFSARSIKLCLVDNQRSSGVGVAGFESC* |
Ga0182167_10443061 | 3300015354 | Switchgrass Phyllosphere | RVYPFLLVFFDSLAGKAFSVRSIKLCLVDNQQSSGVMVAGLQIVSD* |
Ga0182167_10838401 | 3300015354 | Switchgrass Phyllosphere | FDSLAGKAFSARSIKLCLVDNQRSGGVTVVGFEFVSD* |
Ga0182167_11173682 | 3300015354 | Switchgrass Phyllosphere | LLVFFDSLAGKAFSARSIKLCLVDNQWSSGVAVAGFESC* |
Ga0182167_11634791 | 3300015354 | Switchgrass Phyllosphere | DSLAGKAFLARSIKLCLVDNQQNSGVTVAELRIVSD* |
Ga0182167_11982191 | 3300015354 | Switchgrass Phyllosphere | RLRVYTFLLVFFDSLAEKAFLARSIKLCLVDNQQSRGVAVAGFESC* |
Ga0182167_13326361 | 3300015354 | Switchgrass Phyllosphere | VFFDSLAGKVFLARLIKLCLVDNQRSGGVIVADFEFVSD* |
Ga0182197_10183482 | 3300017408 | Switchgrass Phyllosphere | FDSLAGKAFLARSIRLCLVDNQWSGGVTVVGFEFVSD |
Ga0182199_10559392 | 3300017412 | Switchgrass Phyllosphere | LLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFMSD |
Ga0182199_11037061 | 3300017412 | Switchgrass Phyllosphere | VFFDSLAGKDFLARSIKLCLVDNQRSSGVMVAGLRIVS |
Ga0182195_10496531 | 3300017414 | Switchgrass Phyllosphere | DSLAGKAFSARSIKLCLIDNQWSSGVTVAGLRIVSD |
Ga0182201_10281861 | 3300017422 | Switchgrass Phyllosphere | VFFDSLAGKAFLARSIKLCLVDNQWSSGVAVAGFETC |
Ga0182219_10406971 | 3300017424 | Miscanthus Phyllosphere | FLLVLFDSLAGKAFLARSIKLCLVDNQRSSGVMVAGFESRLI |
Ga0182194_11118811 | 3300017435 | Switchgrass Phyllosphere | NFRLRVYPFLLVFFDSRAGKVFSARSIKLCLVDNQWSSGVAVVGFESC |
Ga0182200_10094944 | 3300017439 | Switchgrass Phyllosphere | SFDSLTEKVFSARSIKLCLVDNQQSSGVAVAGFESC |
Ga0182200_10899862 | 3300017439 | Switchgrass Phyllosphere | RVYHFLLMFFDSLAGKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD |
Ga0182200_11041112 | 3300017439 | Switchgrass Phyllosphere | VYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD |
Ga0182217_10653781 | 3300017446 | Switchgrass Phyllosphere | ICNIRLRVYIFLLVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVA |
Ga0182215_11467331 | 3300017447 | Switchgrass Phyllosphere | NFRLRVSTFLLVFFDSLAGKAFLARSIKLCLVDNQRSSGVMVAGFESVSD |
Ga0182216_10327692 | 3300017693 | Switchgrass Phyllosphere | FWLVFFDSLAGKAFLARSIELCSVDNQQSSSVMVAGLQIISD |
Ga0207676_113329122 | 3300026095 | Switchgrass Rhizosphere | LRVYIFLLVFFDSLVGKAFSARSIKLCLVDNQQSSGVTVA |
Ga0268322_10049902 | 3300028049 | Phyllosphere | LLLVFFDLFAGKAFSARSIKLCLFDNKWSSGVTVA |
Ga0268352_10161731 | 3300028057 | Phyllosphere | FLLVFFDSLAGKAFSARSIKLCLVDNQRSYGVAVAGFESCMI |
Ga0268320_10263721 | 3300028153 | Phyllosphere | RLRVSTFLLVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVEGLRIVSD |
Ga0268320_10301831 | 3300028153 | Phyllosphere | HSLVGKTFLARSIELCLVDNQWSSGVMVAGLRIVSD |
Ga0268341_10055391 | 3300028154 | Phyllosphere | DSLAGKAFSARSIKLYLVDNQRSGGVTVAGFEFVSD |
Ga0268316_10030181 | 3300028253 | Phyllosphere | FDSLAGKAFSVRSIKLCLVNNQRSGGVTVAGFEFMSD |
Ga0268264_101092641 | 3300028381 | Switchgrass Rhizosphere | LLVFFDALAGKAFSERSIKLCLVDNQRSYGVAVAGFESCMI |
Ga0268302_1033571 | 3300028464 | Phyllosphere | VYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFMSD |
Ga0268315_10115981 | 3300028472 | Phyllosphere | LRVYPFLLVFFDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD |
Ga0268319_10159621 | 3300028473 | Phyllosphere | DSLARKAFSARSIKLCLVDNQRSGGVTVVGFEFVSD |
Ga0268305_1031262 | 3300028525 | Phyllosphere | LVFFDSLAGKAFSARSIKLCLVDNQRSSGVTVAGFEFVSD |
Ga0268311_10057191 | 3300028529 | Phyllosphere | FDSLAGKAFSARSIKLCLVDNQRSGGVTVAGFEFVSD |
Ga0214493_11305821 | 3300032465 | Switchgrass Phyllosphere | PFLLVFFDSLAEKAFSARSIKLCLVDNQRSGGVMVAGFEFVSD |
Ga0314734_10616571 | 3300032916 | Switchgrass Phyllosphere | PFLHVFFDLLAGKAFLARSIKLFLVDNQWSSGVTVAGLRIVSD |
Ga0314741_10428721 | 3300032934 | Switchgrass Phyllosphere | LVFFDSLAGKAFSARSIKLCLVDNQRSGDVTVAGFEFVSN |
Ga0314759_12020351 | 3300033535 | Switchgrass Phyllosphere | FDSLAGKAFSARSIKLCLVDNQRSGDVTVAGFEFVSD |
⦗Top⦘ |