NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F104373

Metagenome Family F104373

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F104373
Family Type Metagenome
Number of Sequences 100
Average Sequence Length 158 residues
Representative Sequence LKPWKLNRRVGNLSEKLKPVSSDVIRIDFDSFSEPEKQLFSKIWEIQQEYGSSPPADVIEANAEFIFKAWEVIGWRVLELFMFVMGELLGGDEIEEWYFKLHFYNFFEDLKECLERVRKWSEKDREEFLKDMKENDMMNKVFRIPRGSSEEC
Number of Associated Samples 45
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Archaea
% of genes with valid RBS motifs 79.80 %
% of genes near scaffold ends (potentially truncated) 42.00 %
% of genes from short scaffolds (< 2000 bps) 59.00 %
Associated GOLD sequencing projects 43
AlphaFold2 3D model prediction Yes
3D model pTM-score0.59

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Archaea (92.000 % of family members)
NCBI Taxonomy ID 2157
Taxonomy All Organisms → cellular organisms → Archaea

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment
(70.000 % of family members)
Environment Ontology (ENVO) Unclassified
(74.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(54.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 58.33%    β-sheet: 0.00%    Coil/Unstructured: 41.67%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.59
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF02195ParBc 35.00
PF13229Beta_helix 2.00
PF00583Acetyltransf_1 1.00
PF02579Nitro_FeMo-Co 1.00
PF04055Radical_SAM 1.00
PF13412HTH_24 1.00
PF00903Glyoxalase 1.00
PF13646HEAT_2 1.00
PF14947HTH_45 1.00
PF13570PQQ_3 1.00
PF07705CARDB 1.00
PF00589Phage_integrase 1.00
PF00801PKD 1.00
PF03235DUF262 1.00
PF09704Cas_Cas5d 1.00
PF00004AAA 1.00
PF01904DUF72 1.00
PF08241Methyltransf_11 1.00
PF00291PALP 1.00
PF02769AIRS_C 1.00
PF00136DNA_pol_B 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0417DNA polymerase B elongation subunitReplication, recombination and repair [L] 1.00
COG1479DNAse/DNA nickase specific for phosphorothioated or glycosylated phage DNA, GmrSD/DndB/SspE family, contains DUF262 and HNH nuclease domainsDefense mechanisms [V] 1.00
COG1801Sugar isomerase-related protein YecE, UPF0759/DUF72 familyGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms94.00 %
UnclassifiedrootN/A6.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001782|WOR52_10037850All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon8815Open in IMG/M
3300002053|SMTZ23_10040957All Organisms → cellular organisms → Archaea6700Open in IMG/M
3300002053|SMTZ23_10067331All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon7253Open in IMG/M
3300003332|GBSed_10046753All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2724Open in IMG/M
3300003332|GBSed_10161524All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon565Open in IMG/M
3300009034|Ga0115863_1710202All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1126Open in IMG/M
3300009150|Ga0114921_10011268All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4848Open in IMG/M
3300010324|Ga0129297_10137905All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1139Open in IMG/M
3300010324|Ga0129297_10302822All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon720Open in IMG/M
3300010328|Ga0129298_10232363All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon858Open in IMG/M
3300010995|Ga0139323_136448All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon768Open in IMG/M
3300010997|Ga0139324_1061578All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon855Open in IMG/M
3300012931|Ga0153915_11802532All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon716Open in IMG/M
(restricted) 3300013127|Ga0172365_10000920All Organisms → cellular organisms → Archaea → TACK group20754Open in IMG/M
(restricted) 3300013127|Ga0172365_10004873All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon9957Open in IMG/M
(restricted) 3300013127|Ga0172365_10135710All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1544Open in IMG/M
(restricted) 3300013127|Ga0172365_10411661All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon790Open in IMG/M
(restricted) 3300013127|Ga0172365_10462411Not Available736Open in IMG/M
(restricted) 3300013127|Ga0172365_10519065All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon687Open in IMG/M
(restricted) 3300013128|Ga0172366_10004245All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon11305Open in IMG/M
(restricted) 3300013128|Ga0172366_10033066All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3752Open in IMG/M
(restricted) 3300013128|Ga0172366_10133920All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1629Open in IMG/M
(restricted) 3300013129|Ga0172364_10020197Not Available5082Open in IMG/M
(restricted) 3300013129|Ga0172364_10131142All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1723Open in IMG/M
(restricted) 3300013129|Ga0172364_10708456All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon624Open in IMG/M
(restricted) 3300013130|Ga0172363_10030459All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4059Open in IMG/M
(restricted) 3300013130|Ga0172363_10534343All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon747Open in IMG/M
(restricted) 3300013130|Ga0172363_10567842All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon720Open in IMG/M
(restricted) 3300013133|Ga0172362_10061121All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2907Open in IMG/M
(restricted) 3300013133|Ga0172362_10107246All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2094Open in IMG/M
(restricted) 3300013133|Ga0172362_10482744All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon852Open in IMG/M
3300014886|Ga0180300_10088771All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1238Open in IMG/M
3300017966|Ga0187776_11341056All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon543Open in IMG/M
3300018089|Ga0187774_10113560All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1359Open in IMG/M
3300020814|Ga0214088_1376357All Organisms → cellular organisms → Archaea5837Open in IMG/M
3300022551|Ga0212089_10140234All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1244Open in IMG/M
3300022551|Ga0212089_10251946All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon847Open in IMG/M
3300022551|Ga0212089_10322395All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon719Open in IMG/M
3300024263|Ga0209978_10003758All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6869Open in IMG/M
3300024423|Ga0190286_1077846All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon874Open in IMG/M
3300025143|Ga0209314_10216927All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon623Open in IMG/M
3300027888|Ga0209635_10010567All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon7305Open in IMG/M
3300027893|Ga0209636_10009190All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon10070Open in IMG/M
3300027893|Ga0209636_10527159All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon969Open in IMG/M
3300027893|Ga0209636_10907874All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon659Open in IMG/M
3300027893|Ga0209636_11313174Not Available500Open in IMG/M
3300029827|Ga0134606_10090603All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon967Open in IMG/M
(restricted) 3300031587|Ga0315308_1058632All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1695Open in IMG/M
(restricted) 3300031587|Ga0315308_1096982All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1217Open in IMG/M
(restricted) 3300031587|Ga0315308_1206895All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon722Open in IMG/M
(restricted) 3300031587|Ga0315308_1213429All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon707Open in IMG/M
(restricted) 3300031587|Ga0315308_1292975All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon562Open in IMG/M
(restricted) 3300031587|Ga0315308_1333546All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon511Open in IMG/M
(restricted) 3300031587|Ga0315308_1341049All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon502Open in IMG/M
(restricted) 3300031593|Ga0315307_1001305All Organisms → cellular organisms → Bacteria11107Open in IMG/M
(restricted) 3300031593|Ga0315307_1033283All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2040Open in IMG/M
(restricted) 3300031593|Ga0315307_1067706All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1330Open in IMG/M
(restricted) 3300031593|Ga0315307_1151847All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon796Open in IMG/M
(restricted) 3300031593|Ga0315307_1186216All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon695Open in IMG/M
(restricted) 3300031604|Ga0315309_1002156All Organisms → cellular organisms → Archaea → TACK group11589Open in IMG/M
(restricted) 3300031604|Ga0315309_1013263All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4347Open in IMG/M
(restricted) 3300031604|Ga0315309_1034913All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2436Open in IMG/M
(restricted) 3300031604|Ga0315309_1119305All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1103Open in IMG/M
(restricted) 3300031604|Ga0315309_1185284All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon815Open in IMG/M
(restricted) 3300031604|Ga0315309_1237478All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon682Open in IMG/M
3300031707|Ga0315291_10814806All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon811Open in IMG/M
3300031772|Ga0315288_10016349All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon9233Open in IMG/M
(restricted) 3300031806|Ga0315306_10005187All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon5743Open in IMG/M
(restricted) 3300031806|Ga0315306_10056872All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1524Open in IMG/M
(restricted) 3300031806|Ga0315306_10196166All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon749Open in IMG/M
(restricted) 3300031806|Ga0315306_10203911All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon732Open in IMG/M
(restricted) 3300031806|Ga0315306_10223134All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon693Open in IMG/M
3300031862|Ga0315280_10008828All Organisms → cellular organisms → Archaea13129Open in IMG/M
3300031862|Ga0315280_10010074All Organisms → cellular organisms → Bacteria11929Open in IMG/M
3300031862|Ga0315280_10023696All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6389Open in IMG/M
3300031862|Ga0315280_10212867All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1080Open in IMG/M
(restricted) 3300031876|Ga0315310_10025716All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon3371Open in IMG/M
(restricted) 3300031876|Ga0315310_10050508All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2225Open in IMG/M
(restricted) 3300031876|Ga0315310_10192184All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon922Open in IMG/M
(restricted) 3300031877|Ga0315314_1100065All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1217Open in IMG/M
3300031885|Ga0315285_10099776All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2535Open in IMG/M
3300031885|Ga0315285_10783951Not Available600Open in IMG/M
(restricted) 3300031898|Ga0315312_1001856All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon15552Open in IMG/M
(restricted) 3300031898|Ga0315312_1149518All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon679Open in IMG/M
3300031952|Ga0315294_10101918All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2969Open in IMG/M
3300031952|Ga0315294_10121234All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon2686Open in IMG/M
3300031952|Ga0315294_10254037All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1714Open in IMG/M
3300032020|Ga0315296_10127830All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1588Open in IMG/M
3300032020|Ga0315296_10207817All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1166Open in IMG/M
3300032053|Ga0315284_10003464All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon22447Open in IMG/M
3300032069|Ga0315282_10488012All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon704Open in IMG/M
3300032070|Ga0315279_10023852All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon6416Open in IMG/M
3300032070|Ga0315279_10180410All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon1670Open in IMG/M
3300032163|Ga0315281_10000002All Organisms → cellular organisms → Archaea812043Open in IMG/M
3300033513|Ga0316628_103631180Not Available556Open in IMG/M
3300033991|Ga0334965_0000002All Organisms → cellular organisms → Archaea596510Open in IMG/M
3300033991|Ga0334965_0000159All Organisms → cellular organisms → Archaea58962Open in IMG/M
3300033991|Ga0334965_0000676All Organisms → cellular organisms → Archaea26956Open in IMG/M
3300033991|Ga0334965_0012140All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon4719Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment70.00%
Lake SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Lake Sediment7.00%
Marine SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment5.00%
Marine SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Marine Sediment3.00%
SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment2.00%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface2.00%
Marine Hydrothermal Vent SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Hydrothermal Vent Sediment2.00%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.00%
Freshwater WetlandsEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment1.00%
Sediment, IntertidalEnvironmental → Aquatic → Marine → Intertidal Zone → Sediment → Sediment, Intertidal1.00%
Hydrothermal Vent Microbial MatEnvironmental → Aquatic → Marine → Hydrothermal Vents → Microbial Mats → Hydrothermal Vent Microbial Mat1.00%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Granular SludgeEngineered → Bioreactor → Anaerobic → Unclassified → Unclassified → Granular Sludge1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001782Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_deep_samplesEnvironmentalOpen in IMG/M
3300002053Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR_SMTZEnvironmentalOpen in IMG/M
3300003332Marine hydrothermal vent sediment microbial communities from Guaymas Basin, Gulf of California - Sample 1EnvironmentalOpen in IMG/M
3300009034Intertidal mud flat sediment archaeal communities from Garolim Bay, Chungcheongnam-do, KoreaEnvironmentalOpen in IMG/M
3300009150Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaGEnvironmentalOpen in IMG/M
3300010324Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I18A1 metaGEnvironmentalOpen in IMG/M
3300010328Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaGEnvironmentalOpen in IMG/M
3300010995ECM14MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300010997ECM15MPS05_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp)EnvironmentalOpen in IMG/M
3300012931Freshwater wetland microbial communities from Ohio, USA - Open water 3 Core 3 Depth 3 metaGEnvironmentalOpen in IMG/M
3300013127 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cmEnvironmentalOpen in IMG/M
3300013128 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 69cmEnvironmentalOpen in IMG/M
3300013129 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cmEnvironmentalOpen in IMG/M
3300013130 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s2_kivu2a2EnvironmentalOpen in IMG/M
3300013133 (restricted)Sediment microbial communities from Lake Kivu, Rwanda - Sediment s1_kivu2a2EnvironmentalOpen in IMG/M
3300014886Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay15, Core 4569-2, 21-24 cmEnvironmentalOpen in IMG/M
3300017966Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_20_MGEnvironmentalOpen in IMG/M
3300018089Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_20_MGEnvironmentalOpen in IMG/M
3300020814Granular sludge microbial community from anaerobic digester, University of Toronto, Ontario, Canada - UASBVu03_granules megahitEngineeredOpen in IMG/M
3300022551Boni_combined assemblyEnvironmentalOpen in IMG/M
3300024263Deep subsurface microbial communities from South Atlantic Ocean to uncover new lineages of life (NeLLi) - Benguela_00093 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024423Hydrothermal vent microbial mat bacterial communities from Southern Trench, Guaymas Basin, Mexico - 4869-18-3-4_MGEnvironmentalOpen in IMG/M
3300025143Lake sediment bacterial and archeal communities from Gulf of Boni, Indonesia to study Microbial Dark Matter (Phase II) - ?I19B2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027888Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-30_32 (SPAdes)EnvironmentalOpen in IMG/M
3300027893Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-1-52-54 (SPAdes)EnvironmentalOpen in IMG/M
3300029827Marine sediment microbial communities from Barataria Bay, New Orleans, USA to study impact of Deep Water Horizon explosion - M1047EnvironmentalOpen in IMG/M
3300031587 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP3EnvironmentalOpen in IMG/M
3300031593 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP2EnvironmentalOpen in IMG/M
3300031604 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP4EnvironmentalOpen in IMG/M
3300031707Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G12_20EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031806 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP1EnvironmentalOpen in IMG/M
3300031862Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_40EnvironmentalOpen in IMG/M
3300031876 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP5EnvironmentalOpen in IMG/M
3300031877 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP9EnvironmentalOpen in IMG/M
3300031885Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_36EnvironmentalOpen in IMG/M
3300031898 (restricted)Freshwater sediment microbial communities from Lake Towuti, South Sulawesi, Indonesia - TDP7EnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300032020Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G14_18EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032069Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_20EnvironmentalOpen in IMG/M
3300032070Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G06_20EnvironmentalOpen in IMG/M
3300032163Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G07_0EnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300033991Sediment microbial communities from Lake Vrana, Zadar, Croatia - 4 bactEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
WOR52_10037850133300001782Marine SedimentLKSWHLNRRVDDLSEKMKPVSSDVIRLDFDSFSEPEKQLFRKIWEIQEKYGSSPPADVIEANAELVFKAREIIGRRVTELFMFVMKELLGGDEVEEWYFKLHFYNFFEDLKECLANVRKWSEKDREEFLRDMKRDGMINKVFRIPRGFNARNAVKSKKRQKRKDDDRA*
SMTZ23_1004095763300002053Marine SedimentSSSFENVGGEGSEGGVCALKSWHLNRRVDDLSEKLKPVSSDGILIDFDSFTEPEKQLFRKIWEIQEKYGSSPPADVVEANREFIFKAREVISWRVLELFMFVMKELLGGDEIEEWYFKLHFYNFFEDLKECLKNVRKWSEKDREEFLRDMKRDGMINKVFRIPRGFNDRNAVKNKNRQRGKDDE*
SMTZ23_10067331133300002053Marine SedimentSSSFENVGGEGSEGGVCALKSWHLNRRVDDLSEKMKPVSSDVIRLDFDSFSEPEKQLFRKIWEIQEKYGSSPPADVIEANAELVFKAREIIGRRVTELFMFVMKELLGGDEVEEWYFKLHFYNFFEDLKECLANVRKWSEKDREEFLRDMKRDGMINKVFRIPRGFNARNAVKSKKRQKRKDDDRA*
GBSed_1004675323300003332Marine Hydrothermal Vent SedimentLSERLKSVVSDVIRVDFDSFSEPEKRLFNRIWEIQQEYGVSPPVDVIEANKELIFKASEVIVWRVIQLFVFVMKELLVHDEVEEWYFKLHFYNFFADLSECLANVRKWSERDREEFLRDMKENDMMNKVFRIPRSSNTEDLGKRRKRRER*
GBSed_1016152423300003332Marine Hydrothermal Vent SedimentPVASDVIRIDFDSFSESEKRLFKRIWEIQQEYGVSPPSDVIEANKEFIFKASEVIVRRVIQLFMSIMKKLLAQNEVEEWYFKLHFYNFFADLSECLANVRKWSDKDREEFLRDMKESDMINKVFRIPRGSNIEDLRKRWER*
Ga0115863_171020213300009034Sediment, IntertidalLKSSHLNRRVDDLSEKLKPVSSDVIRLDFDSFTEPEKQLFRKIWEIQQEYGSSPPADVIEANKEFIFKAREVISWRVLELFMFVMGEVLGSDEIEEWYFKLHFYNFFEDLKECLKKVRKWSEKDREEFLRDMKQNDMMNKVFRIPRGFNDRNAVKAGKER*
Ga0114921_1001126833300009150Deep SubsurfaceVSDLSEKLKHVSSDVIRIDFDSFSEPEKQLFRRIWEIEQKYGSSPPADVIEANKEFIFKAREVISWRVLELFMFVMGEFLGGDEIEEWYFKLHFYNFSEDLKDCLKNVRKWSEKDREEFLRDMRQNGMMNKVFRIPRGFNDRNAVKSKNRKKGKDDDRA*
Ga0129297_1013790513300010324Lake SedimentMRALSEKLKPVQSDIVTLDFDSFTEPEKQLFRKIWDIQNEYGLSPPDDVLEANKELIFKALEVYSWRVTQLFIYVMEGSLGDDEIEAWYFKLHFYNFFEDLKECLTNVRRWSGKDREEFLKDIKERDMMNKVFRIPSRINEHNTRKTKN
Ga0129297_1030282213300010324Lake SedimentLKSWRLDRKVSVLSENLKPVSSDIIRIDFDSFPEPEKQLFRKVWEIQEKYGSEPPADVIEANAEFIFKAWDVIGWRVLELFMFVMKELLGNDEIEEWYFKLHFYNFFADLSDCLENVRKWSEKDREEFLRDMKEHDMMNKAFRIPRG
Ga0129298_1023236323300010328Lake SedimentMKPWHLDRKVSALSEKLKPISSDVIRIDFNSFPEPEKQLLMKIWEIQEKYGSEPPADVIEANKELIFKAMEVVGWRVLELFMFVMRGLLGGDEIEEWYFKLHFYNFFEDLKECLERVRKWSEKDRGEFLKDMKENDMLNKVFRIPRGPSTEDLRKRRNKREC
Ga0139323_13644823300010995SedimentSLKSWQLDRRVGALAEKLKPVSSDVVGLDFDSFSEPEKQLFRRIWEIQDEYGLSPPSDVLEANAELILKAREVVGWRVLQLFMFVMKELLGGDEVEEWFFKLHFYNFLVDLSDCLGNVHKWSEADRAKFLKDMRESGMIDKVFRIPRGPFAADLRKRKSKREGRGDD*
Ga0139324_106157823300010997SedimentVGALSEKLKPVASDVVGLDFDSFSEPEKQLFRRIWEIQDEYGLSPPSDVLEANAELILKAREVVGWRVLQLFMFVMKELLGGDEVEEWFFKLHFYNFLVDLSDCLGNVHKWSEADRAKFLKDMRESGMIDKVFRIPRGPFAEDLRKRKSKREGRGDD*
Ga0153915_1180253213300012931Freshwater WetlandsPLELSRRVGDLAEKLKPVASDLVHLDFDSFSEPEKQLFRKVWDIHEEYGSPAPAEVVEANKEFIFKATEVVSWRVIELFMFVMKEFLGDEVEEWYFKLHFFNFFEDLKECLVRVRTWSEKDRGEFLRDMKEHDMMNKVYRIPRGPHTGDLRKKRSKRERKSDD*
(restricted) Ga0172365_10000920133300013127SedimentLKSWKLNRRVGDLSEKLEPVQSDVVRLDFDSFPEPEKQLLTKIIEIHRKYGHSPPADVVEANKEFIFKAGEVIGWRVLELFMFVEKTLLGGDEIEEWYFNLHFCNFLADLNECIQRVRKWPERDREEFLSHMKRDGMMDKVFRIPRGFNDRNTVKGKNKREGKADDRA*
(restricted) Ga0172365_1000487323300013127SedimentLKRWGLDKRLDGLSEKLEPASSEGIRIDFDSFPEPEKQLLTKIIEIHRKYGHSPPDDVVEANKEFIFKAGEVIGWRVLELFMFVEKTLLGGDEIEEWYFNLHFCNFLADLNECIQRVRKWPERDREEFLSHMKRDGMMDKVFRIPRGFNDRNSVKSKSKQEEKANDRA*
(restricted) Ga0172365_1013571023300013127SedimentLKSWQLERKISALSEKLKPVSSDVVRLDFDSFTEPEKQLFNRIWEIQRAYGFSPPADVIEANKELIFKASEVIAWRVLELFMFVMKELLEEDEIEEWYFKLHFFNFFEDLKQCLANVRKWSEKDREEFLCDMKEHDMMNKVFRIPRGSNTEEPRKRRSKREGKSGD*
(restricted) Ga0172365_1041166123300013127SedimentMKPVQSDGVRLDFYSFSEAEKQLFNKIWEIQEKYGSSPPADVIEANRELTFKALEIIFRRVLELFIFAVPKVFCWDEIEEWYFKLHFYNFFKDLEECLERVRGWSEKDREEFLRDMKESGMIDKVFRIPHSSGTEDLKTRKKKESKGNG*
(restricted) Ga0172365_1046241123300013127SedimentLKSWQLGRRVEALAEKFKLVQSDIVRLDFDSFTEPEKQLFRKIWEIWDKYGSNPPADVLEANREFFSKAAEVLCGRVFDLFMFLNRELLGEDEIEYWYFKLHFWNFLADLNECLQRVRKWSEKDRQEFLKDMKEHDAMNKVFRIPRGSGGEDLRKRGKKQECKGNG*
(restricted) Ga0172365_1051906513300013127SedimentERSVCALKSWKLNRRVGDLSEQLEPVQSDVVRLDFDSFAEAEKQLFRKVWEIQAKYGDSPPSDVIEANMEFVFKAAEVVSWRVLQMFMFVMRMSFAGDEIEEWYFKLHFYNFFEDLKECLQRVRKWSGKDREEFLADMKRDGMMDKVFRIPRGFNDHNTVRSKSKREGKADG*
(restricted) Ga0172366_1000424523300013128SedimentLKRWGLDKRLDGLSEKLEPASSEGIRIDFDSFPEPEKQLLTKIIEIHRKYGHSPPDDVVEANKEFIFKAGEVIGWRVLELFMFVEKTLLGGDEIEEWYFNLHFCNFLADLNECIQRVRKWPERDREEFLSHMKRDGMMDKVFRIPRGFNDHNTVKSKSKREGKADDRA*
(restricted) Ga0172366_1003306653300013128SedimentLKSWKLNRRVGDLSEKLEPVQSDVVRLDFDSFAEAEKQLFRKVWEIQAKYGDSPPSDVIEANMEFVFKAAEVVSWRVLQMFMFVMRMSFAGDEIEEWYFKLHFYNFFEDLKECLQRVRKWSGKDREEFLRDMKRNDMMGKVFRIPRGPNVEGLKRRRGKRERKKQ*
(restricted) Ga0172366_1013392023300013128SedimentLKPWQLDRKIGALAEKMKPVQSDVVRLDFDSFSEPEKQLFNKIWEIQEKYGSSPPADVIEANRELTFKALEIIFRRVLELFIFAVPKVFCWDEIEEWYFKLHFYNFFKDLEECLERVRGWSEKDREEFLRDMKESGMIDKVFRIPHSSGTEDLKTRKKKESKGNG*
(restricted) Ga0172364_1002019723300013129SedimentLSEQLEPVQSDVVRLDFDSFAEAEKQLFRKVWEIQAKYGDSPPSDVIEANMEFVFKAAEVVSWRVLQMFMFVMRMSFAGDEIEEWYFKLHLGNFFEDLNECLQRVRKWSGKDREEFLRDMKRDDMMDKVFRIPRGPNVEGLKRRRGKRERKKQ*
(restricted) Ga0172364_1013114233300013129SedimentLKSWQLDRKIGVLSEKLKSVQSDVVRLDFDSFSEPEKQLFNRIWEIQEKYGSSPPADVIEANKELTFKALEVIFRRVLELFLFTVPKAFCWDEIEEWYFKLHFYNFFKDLEECLERVRRWSAEDREEFLRDMKESGMIDKVFRIPHSSDVESLKKKRKQERKGDD*
(restricted) Ga0172364_1070845623300013129SedimentKIGALAEKMKPVQSDVVRLDFDSFSEPEKQLFNKIWEIQEKYGSSPPADVIEANRELTFKALEIIFRRVLELFIFAVPKVFCWDEIEEWYFKLHFYNFLKDLEECLERVRGWSEKDREEFLRDMKESGMIDKVFRIPHSSGTEDLKTRKKKESKGNG*
(restricted) Ga0172363_1003045963300013130SedimentLKPWQLDRRVADLSEKLKPVASDVVRLDFDSFSEPEKELFRRILKIQEEYGLNPPADVIEANKELTFKSLEVIFRRVLELFLFAVPKAFCWDEIEEWYFKLHFYNFFEDLEECLANVRRWSERDRQEFLEEMKEHDMMNKVFRIPRNSNADSLSKKTNKRER
(restricted) Ga0172363_1053434313300013130SedimentLKSWQLERKISALSEKLKPVSSDVVRLDFDSFTEPEKQLFNRIWEIQREYGFSPPADVIEANKELIFKASEVIAWRVLELFMFVMKELLEEDEIEEWYFKLHFFNFFEDLKQCLANVRKWSEKDREEFLCDMKE
(restricted) Ga0172363_1056784213300013130SedimentSQERSVCALKSWKLNRRVGDLSEKLEPVQSDVVRLDFDSFAEAEKQLFRKVWEIQAKYGDSPPSDVIEANMEFVFKAAEVVSWRVLQMFMFVMRMSFAGDEIEEWYFKLHFYNFFEDLKECLQRVRKWSLKDREEFLADMKRDGMMDKVFRIPRGFNDHNTVRSKSKREGKADG*
(restricted) Ga0172362_1006112143300013133SedimentVEALAEKFKLVQSDIVRLDFDSFTEPEKQLFRKIWEIWDKYGSNPPADVLEANREFFSKAAEVLCGRVFDLFMFLNRELLGEDEIEYWYFKLHFWNFLADLNECLQRVRKWSEKDRQEFLKDMKEHDAMNKVFRIPRGSGGEDLRKRGKKQECKGNG*
(restricted) Ga0172362_1010724623300013133SedimentLKPWQLDRRVADLSEKLKPVASDVVRLDFDSFSEPEKELFRRILKIQEEYGLNPPADVIEANKELTFKSLEVIFRRVLELFLFAVPKAFCWDEIEEWYFKLHFYNFFEDLEECLANVRRWSERDRQEFLEEMKEHDMMNKVFRIPRNSNADSLSKKTNKRERKSDDRA*
(restricted) Ga0172362_1048274423300013133SedimentLKSWQLNRKIGSLAEKMKPLQSDVVRLDFDSFTESEKQLFNKIWEIQEQYGLNPPADVIEANKELTFKALEIIFRRVLELFIFTVPKAFCWDEIEEWYFKLHFFNFFKDLEDCLANVHRWSEKDREEFLRDMKQSGMMNKVFRIPRNLSNRNTAKGNSKREHKGDD*
Ga0180300_1008877123300014886Marine SedimentLKSWQLKRRVAALSEKLKPVTSDVIRVDFDSFSEPEKRLFNRIWEIQQEYGVSPPVDVIEANKELIFKASEVVVWRVVQLFVFVMEKLLVRDEVEEWYFKLHFYNFFADFSECLANVRKWSDRDCEEFLRDMKENDMMNKVFRIPRGFNTEDLGKRRKRRER*
Ga0187776_1134105623300017966Tropical PeatlandPSDVVRLDFDSFTEAERQLFERIWEIQRQHGSSIPESVAEENRDLIFKAGEVIGWRVIQLFMFTMKQLLEEDEVEEWYFRLHFYNFFADLNECLARVRKWSEKDREEFLNDMKQNGLMDKVFRIPRNLSDNDSVKNEESDHDDGA
Ga0187774_1011356023300018089Tropical PeatlandLKPWELNRRVGNLSEKLKPVPSDVIRIDFDSFPEPEKQLFRKIWEIEQKYGSSPPADVIEANAEFIFKAWDVIGWRVLELFMFVMQELLAEDEIEEWYFKLHFYNFFEDLNECLQRVRKWSEKDREEFLKDMKENDMMNKVFRIPRGFNDRNTAGGSQR
Ga0214088_137635763300020814Granular SludgeLKSWQLNKRVGDLSEKLTPVNSGVVRLDYYSFTEPEKQLFNKISEMQDKYGDSPPADVLEANREFIFKALEVISGRVLELFMFVNQELLGDEIEAWYFKLHFYNFFVDLNECLQRVRKWPEDERERFLKDMKTSGNIDRAFRIPRGPETEFKKKKARGS
Ga0212089_1014023423300022551Lake SedimentMKPWELNKRVGNLSEKFKPVSSDVIRLDFDSFTEPEKQLFSKIWEIQQEYGSSPPADVIEANAEFIFKAWEVIGWRVLELFMFVMGELLGGDEIEEWYFKLHFYNFFEDLKECLERVRNWSEKDREEFLKDMKESGMLNKVFRIPRGSSVKDLRKRGSVREHEGK
Ga0212089_1025194613300022551Lake SedimentLKSWLLDRRMRALSEKLKPVQSDIVTLDFDSFTEPEKQLFRKIWDIQNEYGLSPPDDILEANKELIFKALEVYSWRVTQLFIYVMEGSLGDDEIEAWYFKLHFYNFFEDLKECLTNVRRWSGKDREEFLKDIKERDMMNKVFRIPSRINEHNTR
Ga0212089_1032239523300022551Lake SedimentVGALSEKLKPVSSDVIRLDFDSFSEPEKQLFTRIWEIEQEYGSSPPADVIEANKEFIFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLEHVRKWSEKDREEFLRDMKENDMMNRVFRIPRGFNDCNTVKSKNRAGGER
Ga0209978_1000375853300024263Deep SubsurfaceLSEKLKHVSSDVIRIDFDSFSEPEKQLFRRIWEIEQKYGSSPPADVIEANKEFIFKAREVISWRVLELFMFVMGEFLGGDEIEEWYFKLHFYNFSEDLKDCLKNVRKWSEKDREEFLRDMRQNGMMNKVFRIPRGFNDRNAVKSKNRKKGKDDDRA
Ga0190286_107784623300024423Hydrothermal Vent Microbial MatLSEKLKSVVSDAIRVDFDSFSEPEKRLFNRIWEIQQEYGVSPPVDVIEANKELIFKASEVIVRRVIQLFMSIMKKLLVHDEVEEWYFKLHFYNFFADLSECLANVRKWSDRDREEFLRDMKENDMMNKVFRIPRSSNTEDLGKRRKRRDH
Ga0209314_1021692723300025143Lake SedimentLKSWRLDRRVGALSEKLKPVSSEVIRLDFDSFSEPERQLFERIWEIEREYGSSPPADVVEANKEFVFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLENVRKWSERDRDEFLRDMKENDMMNRVFRIP
Ga0209635_1001056723300027888Marine SedimentLKSWHLNRRVDDLSEKLKPVSSDGILIDFDSFTEPEKQLFRKIWEIQEKYGSSPPADVVEANREFIFKAREVISWRVLELFMFVMKELLGGDEIEEWYFKLHFYNFFEDLKECLKNVRKWSEKDREEFLRDMKRDGMINKVFRIPRGFNDRNAVKNKNRQRGKDDE
Ga0209636_1000919023300027893Marine SedimentLSEKLKPVSSDVIRLDFDSFTEPEKQLFRKIWEIEREYGVSPPADVIEANKEFIFKASEVIAWRVIELFMFVMKELLGGDEIEEWYFKLHFFNFFEDLSECLANVRRWSEKDREEFLRDMNQDDMMNKVFRIPRGSSTEDLRKTRNKRERKGDN
Ga0209636_1052715913300027893Marine SedimentMKPVSSDVIRLDFDSFSEPEKQLFRKIWEIQEKYGSSPPADVIEANAELVFKAREIIGRRVTELFMFVMKELLGGDEVEEWYFKLHFYNFFEDLKECLANVRKWSEKDREEFLRDMKRDGMINKVFRIPRGFNARNT
Ga0209636_1090787423300027893Marine SedimentLKTWKLNRRVGNLSEKLKPVSSDVIRIDFDSFPEPEKQLFSKIWEIQQEYGSSPPADVIEANKEFIFKAREVISWRVIELFIFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLKNVRKWSEKNREDFLRDMKQDDMLNKV
Ga0209636_1131317413300027893Marine SedimentLKSWQLDRRVGALAEKLKPVSSDVVGLDFDSFSEPEKQLFRRIWEIQDEYGLSPPSDVLEANAELILKAREVVGWRVLQLFMFVMKELLGGDEVEEWFFKLHFYNFLVDLSDCLGNVHKWSEADRAKFLKDMRESGMIDKVF
Ga0134606_1009060323300029827Marine SedimentLKPLQLNRRLGDLSKKLEPAKSDVVRLDFDSFTEPEKQLFRKIWEVQEKYRGSPPADVIEANKEFIFKAIEVLSWRVLELFIFVNSVLLDDEIEDWYFKLHFYNFFEDLKECLQRVRKWHEEERERFLKDMKESGMINRVFRIPRGSDKEDIRKRRKRRE
(restricted) Ga0315308_105863223300031587SedimentVKSLHLDRRINALSEKLKPVSSDVIRLDFDSFSEPEKQLFRKVWEIEQEYGSSPPADVVEANREFVFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLEHVRKWSEKDREEFLLDMKQDNWINKVFRIPRGFNDCNTVKSKNRAGEGR
(restricted) Ga0315308_109698223300031587SedimentLKPWLLNRRVGNLSEKLKDVPFDGIRIDFDSFTEPEKQLFRKIWEIQEKYGFEPPADVIEANKEFIFKAWEVIGWRVLELFMFVMGELLGGDEIEEWYFKLHFYNFFEDLNECLERVRKWSEKDREEFLKDMKENDMMNKV
(restricted) Ga0315308_120689523300031587SedimentLKPWKLNRRVGNLSEKLKPVSSDVIRIDFDSFSEPEKQLFSKIWEIQQEYGSSPPADVIEANAEFIFKAWEVIGWRVLELFMFVMGELLGGDEIEEWYFKLHFYNFFEDLKECLERVRKWSEKDREEFLKDMKENDMMNKVFRIPRGSSEEC
(restricted) Ga0315308_121342923300031587SedimentVSFEGFGRESLERCVCALKTWQLNRRVGALSEKLKPVSSEVIRLDFDSFSEPEKELFMKVWEIEREYGSSPPADVIEANKELIFKASEVIGWRVIQLFMFAMKELLGNDEVEEWYFKLHFYNFFEDLNECLANVRKWSEKDREEFLRDMKQ
(restricted) Ga0315308_129297513300031587SedimentSSDVIRLDFDSFSEPERQLFRKIWEIEREHGSSPPADVVETNAEFIFKASEVVGWRVIQLFMFVMKELLSNDEIEEWYFKLHFYNFFEDLKECLANVRKWSEKDRDEFLRDMKENDMMNKVFRIPRGFNDCNTVKSKNRAGEER
(restricted) Ga0315308_133354623300031587SedimentLSEKLKPVSSDVIRLDFDSFTEPEKQLFRKIWEIQQEYGSSPPADVIEANKELIFKAMEVISWRVLELFIFVMSEVLEGDEIEVWYFKLHFYNFFEDLKECLERVRKWSDKDREEFLKDMKESDMMNKVFRIPRGPSTEDLRKGRNKRERR
(restricted) Ga0315308_134104913300031587SedimentGDSQSLEGVGGQSAEGSVCALKSWRLDRKVSVLSENLKPVSSDIIRIDFDSFPEPEKQLFRKVWEIQEKYGSEPPADVIEANAEFIFKAWDVIGWRVLELFMFVMKELLGNDEIEEWYFKLHFYNFFADLSDCLENVRKWSEKDREEFLRDMKEHDMMNKAFRIPR
(restricted) Ga0315307_1001305113300031593SedimentMKPWELNKRVDCLSEKLKPVSSEGIRIDFDSFPEPEKQLFRKIWEIQEKYGSSPPADVIEANKEFIFKAWEVIGWRVLELFMFVMQELLGGDEIEEWYFKLHFYNFFEDLKECLERVRKWSEKDREEFLKDMKESDMLNKVFRIPRGSSVKDLRKRGSMREPEGK
(restricted) Ga0315307_103328323300031593SedimentMKPWKLNRRMGNLSEKLKDVPSDGIRIDFDSFPEPEKQLLMKVWEIQEKYGSEPPADVIEANAEFIFKAWDVIGWRVLELFMFVMKELLGNDEIEEWYFKLHFYNFFADLSDCLENVRKWSEKDREEFLRDMKEHDMMNKAFRIPRGPTAEDLRKRRSKREHRGR
(restricted) Ga0315307_106770623300031593SedimentMKPWELNKRVGNLSEKFKPVSSDVIRLDFDSFTEPEKQLFSKIWEIQQEYGSSPPSDVIEANKEFIFKAGEVIGWRVLQLFMFVMKELLDNDEIEEWYFKLHFYNFLEDLKECLQRVRKWSEKDREEFLKDMKERGMLNKVFRIPRGPNTEDLRKRRNKRERRGDD
(restricted) Ga0315307_115184723300031593SedimentVKSLHLDRRINALSEKLKPVSSDVIRLDFDSFSEPEKQLFRKVWEIEQEYGSSPPADVVEANREFVFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLEHVRKWSEKDREEFLRDMKQDNMMNKVFRIPRGFNDCNTVKSKNRAGEGR
(restricted) Ga0315307_118621623300031593SedimentVGALSEKLKPVSSEVIRLDFDSFSEPERQLFMKIWDIEKEYSSSPPADVIESNAEFIFKAREVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLDHVRKWSEKDREEFLRDMKQDNRINKVFRIPRGFND
(restricted) Ga0315309_100215623300031604SedimentLKPWKLNRRVGNLSEKLKPVSSDVIRIDFDSFSEPEKQLFSKIWEIQQEYGSSPPADVIEANAEFIFKAWEVIGWRVLELFMFVMGELLGGDEIEEWYFKLHFYNFFEDLKECLERVRNWSEKDREEFLKDMKESGMLNKVFRIPRGSSVKDLRKRGSVREHEGK
(restricted) Ga0315309_101326353300031604SedimentVGALSEKLKPVSSDVIRLDFDSFSESEKQLFRKIWEIQQEYGSSPPADVIEANREFIFKASEVIGWRVIELFMFVMKELLGNDEIEEWYFKLHFYNFFADLSDCLENVRKWSEKDREEFLRDMKEHDMMNKVFRIPRGPTAEDLRKRRSKREHRGR
(restricted) Ga0315309_103491323300031604SedimentLKSWRLDRKVSVLSENLKPVSSDIIRIDFDSFPEPEKQLFRKVWEIQEKYGSEPPADVIEANAEFIFKAWDVIGWRVLELFMFVMKELLGNDEIEEWYFKLHFYNFFADLSDCLENVRKWSEKDREEFLRDMKEHDMMNKAFRIPRGPTAEDLRKRRSKREHRGR
(restricted) Ga0315309_111930513300031604SedimentMKPWHLERRMHALSEKLKPVSSDVIRLDFDSFPEPEKQLFTKIWEIQAKYGSSPPADVIEANAELIFKARDVVSWRVLELFVFVMKELLGNDEIEEWYFKLHFYNFFADLSDCVKNVRKWSEKDREEFLRDMKQNDMMNKVFRIPRGFNEHNTCEGKNKKKA
(restricted) Ga0315309_118528423300031604SedimentWLLNRRVGNLSEKLKPVSSDVIRLDFDSFSEPEKQLFRKIWEIQQEYGSSPPADVIEANKELIFKAMEVISWRVLELFIFVMSEVLEGDEIEVWYFKLHFYNFFEDLKECLERVRNWPEKDRKEFLKDMKENDMMNKVFRIPRGFNEHNTAKDKKEQEGDSDD
(restricted) Ga0315309_123747813300031604SedimentLRSWRLDRRVGALSEKLKPVSSDVIRLDFDSFSEPEKQLFERIWEIERAYGSSPPADVVEANKEFVFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLNECLENVRKWSEKDRDEFLRDMKENDMMNKVFRIPRGFNDCNTVK
Ga0315291_1081480613300031707SedimentKLKPVSSDVIRIDFDSFTEPEKQLFRKIWEIQAKYGSSPPAEVMEANREFIFKAGEVVSWRVLELFMFVMREALLGDEIEEWYFKLHFYNFLADLSECLKRVRKWSEKDREEFLRDMKENDMMNRVFRIPRGFNEHNTAKGKDKQEKEGSD
Ga0315288_10016349113300031772SedimentVGALSEKLKPVSSDVIRLDFDSFSEPEKQLFRKIWEIQQEYGSSPPADVIEANKEFVFKASEVLSWRVLELFMFVIKELLRHDEIEEWYFKLHFYNFFEDLAECLANVRKWSEKDREEFLGDMKRDNMINKVFRIPRGFNDRNTVKSKNRQKGKADG
(restricted) Ga0315306_1000518783300031806SedimentMKSWQLDRRVGVLSEKLKPLTSDVIRLDFDSFSEPEKELFNKIWEIQREYGLSPPADVIDANKELIFKSREIIGWRVIQLFMFVMKEFLEQDEIEEWYFKLHFYNFFEDLKECLANVRKWSEKDREEFLLDMKENDMMNKVFRIPRGFNKNDTPKTDKKKAKVDD
(restricted) Ga0315306_1005687223300031806SedimentMKSWHLDRRVGALSEKLKPVASDVVRLDFDSFSEAEKQLFNRIWEIQNEYGLNPPADVIEKNRELIFKASEVLGWRVIQLFIFVMKELLHEDEIEEWFFKLHFFNFFEDLKECLANVRRWSEKDREEFLRDMKEHDAMNKVFRIPSRINDHKIVKDKNKKKAKVND
(restricted) Ga0315306_1019616613300031806SedimentPASSDVLRLDFDSFSEPEKQLFRKIWEMEQEYGSSPPADVIEANAELIFKAREVIGWRVLELFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLEHVRKWSEKDRDEFLRDMKENDMMNRVFRIPRGSSTEDLRKKRNKREPKGDG
(restricted) Ga0315306_1020391113300031806SedimentRIDFNSFPEPEKQLFSKIWEIQEKYGSEPPADVIEANKELIFKAMEVVGWRVLELFMFVMRGLLGGDEIEEWYFKLHFYNFFEDLKECLERVRKWSEKDREEFLEDMKESGMINKVFRISRGSSVKDLRKQGSMREHEGK
(restricted) Ga0315306_1022313423300031806SedimentLKSWRLDRRVGALSEKLKPVSSDVIRLDFDSFSEPEQQLFERIWEIEREYGSFPPADVVETNAEFIFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLGRVRKWSEKDREEFLRDMKQHNMINKVFRIPRGFNDCNTVKSKNRAGEGR
Ga0315280_1000882883300031862SedimentLKSSHLDRRVGALSEKLKPVSSDVIRIDVDSFSEPEKQLFRKIWEIEEKYGFSPPADVIEANWELIFKAREIVAWRVIELFMFVMKELLGHDEIEEWYFKLHFFNFFEDLKECLVNVRKWSEKDREEFLRDMKRDNMINKVFRIPRSLNDHNTVKSKNRQKGKADD
Ga0315280_1001007453300031862SedimentLKSWHLDRKVGDLSEKLKPVSSDVVRLDFDSFTEPEKQLFSKIREIEQEYGLSPPADVIEANAELIFKAREIIAWRVIELFMFVMKELLGHDEIEEWYFKLHFFNFFEDLKECLANVRKWSEKDREEFLSDMKRDNMINKVFRIPRSLNDRNTVKSKKKREGKDDG
Ga0315280_1002369643300031862SedimentLKSWHLDRRVGALSEKLKPVSSDVIRIDFDSFTEPEKQLFSKIREIEQEYGFSPPADVIEANWELIFKAREIIAWRVIELFIFVMKELLRGDEIEEWYFKLHFYNFFEDLKECLANVRKWCEKDREEFLLDMKQYDMMNKVFRIPRGLNDRNTAKSKKKREGKHDD
Ga0315280_1021286713300031862SedimentLKSSHLDRRVGALSEKLKPVSSDVIRIDVDSFSEPEKQLFRKIWEIEQKYGFSPPADVIEANWELIFKAREIVAWRVIELFMFVMKELLGHDEIEEWYFKLHFYNFFEDLKECLANVRKWSEKDQEEFLRDMKRDNMINKVFRIPRSLNGR
(restricted) Ga0315310_1002571623300031876SedimentLKSWRLDRRVGALSEKLKPVSSEVIRLDFDSFSEPEKQLFRKIWEIEREYGSSPPADVVEAHKEFVFKASEVIGWRVIQLFMFVMKGLLGNDEIEEWYFKLHFYNFFEDLKECLGRVRKWSEKDREEFLLDMKQDNMINKVFRIPRGFNDCNTVKSKNRAGGER
(restricted) Ga0315310_1005050813300031876SedimentMKPWELNKRVGNLSEKFKPVSSDVIRLDFDSFTEPEKQLFSKIWEIQQEYGSSPPSDVIEANKEFIFKAGEVIGWRVLQLFMFVMKELLDNDEIEEWYFKLHFYNFLEDLKECLQRVRKWSEKDREEFLKDMKERGMLNKVFRIPRGPNTED
(restricted) Ga0315310_1013352213300031876SedimentVKSLHLDRRINALSEKLKPVSSDVIRLDFDSFSEPEKQLFRKVWEIEQEYGSSPPADVVEANREFVFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLEHVRKWSEKDREEF
(restricted) Ga0315310_1019218423300031876SedimentMKSWHLNRRMGALSEKLKPVPSEVIRLDLDSFSEPEKQLFERVWEIESEYGSSPPADVIEANKEFVFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFLEDLKECLENVRKWSEKDREEFLLDMKQNDMMNKVFRIPRGPSTENLRKKRNKQEPKGDD
(restricted) Ga0315314_110006533300031877SedimentLKSWQIDKRVADLSEKLKPVQSEVVVLDFDFFSESEKQLFKKIWEIQEEYGLNPPSDVVEANKELTFKALEIIFRRVLELFIFTVPKAFCWDEIEEWFFKLHFFNFFEDLEECLANVRRWSEKDREEFLEDMKEHDMMNKVFRIPRSSNTDGPGKKRNRQECKNH
Ga0315285_1009977623300031885SedimentLKPWQLDRRVDSLSEKLKPLSSEGIRIDLDSFPEPEKQLLRKILEINEKYGSSPPADVIEANKEFIFKATEVIGWRVFELFMFVMRELLGEDEIEEWYFKLHFCNFLVDLNECLQRVRKWSLKDREEFLSHMKQDGMMNKFVRIPRGFNDRNTVKSKNKRGGKADD
Ga0315285_1078395123300031885SedimentLKPWELSRRVGNLSEKLKDVPFEGIRIDLDSFPEPEKQLFRKILEIQGKNGSEPSAEVIEANAEFIFKAREVIGWRILELFMFVMRELLGDEIEEWYFKLHFCNFLVDLNECLQRVRKWSLKDREEFLSHMKQDGMMNKFVRIPRG
(restricted) Ga0315312_100185633300031898SedimentLKPWLLERKMRALSEKLKPVQSDIVTLDFDTFTEPEKQLFRKIWDIQNEYGLSPPDDVLEANKELIFKALEVYSWRVTQLFISVMEGSLGDDEIEAWYFKLHFYNFFEDLKECLTNVRRWSGKDREEFLKDMKEHDMMNKVFRIPSRINEHNTRKTKNKKKAKVND
(restricted) Ga0315312_114951813300031898SedimentLKSWRLDRRVGALSEKLRPVSSDVIRLDFDSFSEPERQLFERVWEIEREYGSSPPADVIEANKEFIFKASEVIGWRVIQLFMFVMKELLGNDEIEEWYFKLHFYNFFEDLKECLKNVRKWSEKDREEFLRDMKEHDMMNKVFRIPRGSTAEDLRKK
Ga0315294_1010191823300031952SedimentVGNLSEKLKDVPFEGIRIDLDSFPEPEKQLFRKILEIQGKNGSEPSAEVIEANAEFIFKAREVIGWRILELFMFVMRELLGDEIEEWYFKLHFCNFLVDLNECLQRVRKWSLKDREEFLSHMKQDGMMNKFVRIPRGFNDRNTVKSRNKRGGKHSD
Ga0315294_1012123423300031952SedimentVSALSEKLKPVSSDVIRIDFDSFTEPEKQLFRKVWEIEQKYGSSPPADVLEANNEFIFKAGEVISWRVLELFMFVMRQALLGDESEEWYFKLHFYNFLEDLKDCLANVRKWSEKDREEFLRDMKQDNMMNKVFRIPRGFNDRNAVKSKNGEEGKDDD
Ga0315294_1025403733300031952SedimentVNVLSEKLKPVPSDVVRIDFDSFTEPEKQVFRKVWEVEQEYGSSPPAEVLKANMAFIFKATEIVSWRVVELFMFVMRETLGGDEIEDWYFKLHFYNFFEDLAECLKRVRNWSEKDRQEFLEDMKQHGGLNKVFRIPRGFNEHNSVRRKKREGKNDV
Ga0315296_1012783023300032020SedimentLKSWQLNRRVDDLSEKLKTVQSDVVRLDFDSFTEPEKQLFRKVWEIQAKYGDSPPADVVEANREFIFKATEVISWRVLELFMFVMRELLGEDEIEEWYFKLHFYNFFEDLNECLQRVRNWPQKEREKFLKDMKESGMINKAFRFPRGPSVEDLKKRRNKQERKGDE
Ga0315296_1020781723300032020SedimentFSEPEKQLFRKIWEIEQEYGYSPPADVIEANAEFIFKAREIIAWRVIELFMFVMKELLGHDEIEEWYFKLHFYNFLEDLKECLANVRKWSEKDREEFLRDMKRDNMINKVFRIPRGFNDRNTVKSKKKREGKDDG
Ga0315284_10003464153300032053SedimentVDDLSEKLKSVPSDVVRIDFDSFSEPEKQVFRKVLEIEEKYGASPPADVLKANMEFVFKAREIVSWRVVELFMFVMRETLGGDETEDWYFKLHFYNFFADLAECLANVRKWSEKDREEFRDDMKQNDGWNKVFRIPRGFTEHNTVKRKKGKEEKNDV
Ga0315282_1048801223300032069SedimentLKSSHLDRRVGALSEKLKPVSSDVIRIDVDSFSEPEKQLFRKIWEIEEKYGFSPPADVIEANWELIFKAREIVAWRVIELFMFVMKELLGHDEIEEWYFKLHFFNFFEDLKECLVNVRKWSEKDREEFLRDMKRDNMINKVFRIPRSLNDHNTVKSKNR
Ga0315279_1002385243300032070SedimentMKSWHLDRRANALSEKLKSVSSDVIRIDFDSFCEPEKQLFRKIWEIEQEYGFSPPADVIEANAELVSKAREIIGWRVIELFMFVMKELLGRDEIEEWYFKLHFYNFLEDLKNCLENVRKWSDKDREEFLRDMKRDNMINKVFRIPRSLNDHNTVKSKKKREGKHDD
Ga0315279_1018041033300032070SedimentLKSWHLDKRVESLSEKLKPVPSEGIRIDLESFTEPEKQLLRKVLEINEEYGSSPPAEVIEANKEFIFKATEVIGWRVFELFMFVMRELLGEDEIEEWYFKLHFCNFFADLNECLKRVRKWSGKDREEFLSHMKQDGMMNKFVRIPRGFNERNTMKSKNKRGGKDDDSV
Ga0315281_100000023443300032163SedimentLKPWELSRRVGDLSEKLKDVPFEGIRVDFDSFPEPEKQLFRRILEIEEKYDSSPPADVIEANKEFIFKALEIISWRVLELFMFVMKESLGGDEIEGWYFKLHFCNFFADLNECLQRVRKWSEKDREEFLRHMKQDGMMNKFVRIPRGFNDRNTVKSKNRRDGKADG
Ga0316628_10363118013300033513SoilDLDRRMNSLSEKLKRVPSGGIRIDLDSFSEPERQLFRKVWEIGEQYGSSPLAEVIEANGEFIFKAVEVVSGRVLELFMFVFGHAFLGDEIEEWFFKLHFYNFLADLADCLENVRRWSEKDREEFLNSMRPDDGLNRVFRFPRGASVHNAVEDENEGEVKGDD
Ga0334965_0000002_568516_5689713300033991SedimentMKSVSSDDIVVLDFDFFTEPEKQLFRKIWEIQNEYGLNPSADVLEANKELIFKALEVYSWRVTQLFISVMEGSLGNDEIEIWYFKLHFYNFFEDLAECLERVRRWSEKDREEFLNDMKQSGMMNKVFRIPSRINEHNTQKAKNKKKAKVND
Ga0334965_0000159_52577_530503300033991SedimentVGALSEKLKPVPSDVVRLDFDSFTEPEKQLFNRFWEIQEEYGLNPSSDVIEANKELIFKASEIVAWRVIELFMFVMKELLEHDEIEEWYFKLHFYNFFEDLKECLANVRKWSEKDREEFLRDMKRDDMINKVFRIPRGFNDHDTVKSKNKREAKHDD
Ga0334965_0000676_4111_45753300033991SedimentLSEKLKPVPSDVIRLDFDSFSEPEKQLFRKIWEIEEKYGSSSPPADVAEANKELVFKAGEVIGWRVIQLFMFAMRQLLLEDEVEVWYFKLHFYNFFADLSDCLERVRKWSEKDREEFLRDMKEGGMLDKVFRIPRGVNEHNATADKTEEKKGEE
Ga0334965_0012140_540_9953300033991SedimentMKTVPSDDIVVLDFGFFTEPEKQLFRKIWEIQSEYGLNPPADVLEANKELIFKALEVYSWRVIQLFISVMEGSLGNDEIEVWYFKLHFYNFFEDLKECLANVRRWSEKDREEFLKDMKEHDMMNKAFRIPRGSSTEELKRRRNKRESRSGD

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.