NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105296

Metagenome / Metatranscriptome Family F105296

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105296
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 69 residues
Representative Sequence MLRNPNSIPTGDTIIQDPVMEPFFITRSQTGGYTVYERVIKGENNTEYIKTISYPSNFGYALKTVA
Number of Associated Samples 93
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Viruses
% of genes with valid RBS motifs 1.02 %
% of genes near scaffold ends (potentially truncated) 91.00 %
% of genes from short scaffolds (< 2000 bps) 90.00 %
Associated GOLD sequencing projects 88
AlphaFold2 3D model prediction Yes
3D model pTM-score0.82

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Duplodnaviria (77.000 % of family members)
NCBI Taxonomy ID 2731341
Taxonomy All Organisms → Viruses → Duplodnaviria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater
(21.000 % of family members)
Environment Ontology (ENVO) Unclassified
(47.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(92.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 14.89%    β-sheet: 31.91%    Coil/Unstructured: 53.19%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.82
Powered by PDBe Molstar

Structural matches with SCOPe domains

SCOP familySCOP domainRepresentative PDBTM-score
b.69.4.1: WD40 repeat-liked1s4ux_1s4u0.63
b.68.3.1: Thermostable phytase (3-phytase)d3amra_3amr0.61
d.107.1.1: Mog1p/PsbP-liked1jhsa_1jhs0.6
b.69.4.1: WD40 repeat-liked1pgua11pgu0.6
d.108.1.1: Acyl-CoA N-acyltransferases (Nat)d2p0wa_2p0w0.6

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF00085Thioredoxin 78.00
PF02867Ribonuc_red_lgC 12.00
PF01165Ribosomal_S21 1.00
PF00268Ribonuc_red_sm 1.00
PF06508QueC 1.00
PF01592NifU_N 1.00
PF14902DUF4494 1.00
PF10107Endonuc_Holl 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0209Ribonucleotide reductase alpha subunitNucleotide transport and metabolism [F] 12.00
COG0037tRNA(Ile)-lysidine synthase TilS/MesJTranslation, ribosomal structure and biogenesis [J] 1.00
COG0137Argininosuccinate synthaseAmino acid transport and metabolism [E] 1.00
COG0171NH3-dependent NAD+ synthetaseCoenzyme transport and metabolism [H] 1.00
COG0208Ribonucleotide reductase beta subunit, ferritin-like domainNucleotide transport and metabolism [F] 1.00
COG0301Adenylyl- and sulfurtransferase ThiI (thiamine and tRNA 4-thiouridine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.00
COG0482tRNA U34 2-thiouridine synthase MnmA/TrmU, contains the PP-loop ATPase domainTranslation, ribosomal structure and biogenesis [J] 1.00
COG0519GMP synthase, PP-ATPase domain/subunitNucleotide transport and metabolism [F] 1.00
COG06037-cyano-7-deazaguanine synthase (queuosine biosynthesis)Translation, ribosomal structure and biogenesis [J] 1.00
COG0780NADPH-dependent 7-cyano-7-deazaguanine reductase QueF, C-terminal domain, T-fold superfamilyTranslation, ribosomal structure and biogenesis [J] 1.00
COG0822Fe-S cluster assembly scaffold protein IscU, NifU familyPosttranslational modification, protein turnover, chaperones [O] 1.00
COG0828Ribosomal protein S21Translation, ribosomal structure and biogenesis [J] 1.00
COG1606ATP-utilizing enzyme, PP-loop superfamilyGeneral function prediction only [R] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.00 %
UnclassifiedrootN/A12.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2222084003|2222440588Not Available538Open in IMG/M
3300002483|JGI25132J35274_1079238All Organisms → cellular organisms → Bacteria → Proteobacteria → unclassified Proteobacteria → Proteobacteria bacterium681Open in IMG/M
3300003216|JGI26079J46598_1049364All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes858Open in IMG/M
3300004054|Ga0063232_10013940All Organisms → cellular organisms → Bacteria1818Open in IMG/M
3300004279|Ga0066605_10271829Not Available629Open in IMG/M
3300004448|Ga0065861_1052715All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes991Open in IMG/M
3300005510|Ga0066825_10139782All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes889Open in IMG/M
3300006357|Ga0075502_1545279All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes644Open in IMG/M
3300006752|Ga0098048_1220044All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes558Open in IMG/M
3300006867|Ga0075476_10210539All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes705Open in IMG/M
3300006924|Ga0098051_1177570All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes559Open in IMG/M
3300007344|Ga0070745_1282837All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes594Open in IMG/M
3300007346|Ga0070753_1217578All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes702Open in IMG/M
3300007538|Ga0099851_1030607All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2154Open in IMG/M
3300007541|Ga0099848_1257422All Organisms → cellular organisms → Bacteria609Open in IMG/M
3300007554|Ga0102820_1171477All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes525Open in IMG/M
3300007960|Ga0099850_1170437All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales868Open in IMG/M
3300009000|Ga0102960_1156048All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes821Open in IMG/M
3300009001|Ga0102963_1063978All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1514Open in IMG/M
3300009002|Ga0102810_1006943All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes4054Open in IMG/M
3300009027|Ga0102957_1421371All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes501Open in IMG/M
3300009059|Ga0102830_1175215All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes628Open in IMG/M
3300009080|Ga0102815_10706025All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes570Open in IMG/M
3300012928|Ga0163110_10279560All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1214Open in IMG/M
3300012952|Ga0163180_10705451All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes780Open in IMG/M
3300012953|Ga0163179_10529705All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes979Open in IMG/M
3300016734|Ga0182092_1162349All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes530Open in IMG/M
3300016734|Ga0182092_1204707All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes561Open in IMG/M
3300016737|Ga0182047_1428249All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes659Open in IMG/M
3300016749|Ga0182053_1093580All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes671Open in IMG/M
3300016771|Ga0182082_1039828All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes557Open in IMG/M
3300017697|Ga0180120_10035865All Organisms → cellular organisms → Bacteria2273Open in IMG/M
3300017714|Ga0181412_1136933All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes556Open in IMG/M
3300017742|Ga0181399_1066205All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes923Open in IMG/M
3300017746|Ga0181389_1149240All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes623Open in IMG/M
3300017751|Ga0187219_1097033All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes900Open in IMG/M
3300017760|Ga0181408_1179988All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → Winogradskyella → unclassified Winogradskyella → Winogradskyella sp.540Open in IMG/M
3300017768|Ga0187220_1118632All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes800Open in IMG/M
3300017779|Ga0181395_1137907All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria771Open in IMG/M
3300017967|Ga0181590_10301259All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1166Open in IMG/M
3300017967|Ga0181590_10371350All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1022Open in IMG/M
3300018036|Ga0181600_10236536All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes951Open in IMG/M
3300018417|Ga0181558_10642631All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes543Open in IMG/M
3300018428|Ga0181568_10616466All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes854Open in IMG/M
3300020175|Ga0206124_10176021Not Available853Open in IMG/M
3300020442|Ga0211559_10072879Not Available1670Open in IMG/M
3300020457|Ga0211643_10253416All Organisms → cellular organisms → Bacteria864Open in IMG/M
3300021368|Ga0213860_10340367All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes653Open in IMG/M
3300021373|Ga0213865_10448649All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes561Open in IMG/M
3300021957|Ga0222717_10565596All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes602Open in IMG/M
3300021958|Ga0222718_10047110All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2764Open in IMG/M
3300021959|Ga0222716_10284148All Organisms → cellular organisms → Bacteria1006Open in IMG/M
3300022187|Ga0196899_1214990All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes504Open in IMG/M
3300023693|Ga0232112_1010603All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1011Open in IMG/M
3300023709|Ga0232122_1055994All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes977Open in IMG/M
3300024228|Ga0228633_1089748Not Available726Open in IMG/M
3300024230|Ga0228638_1078614All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes834Open in IMG/M
3300024231|Ga0233399_1141620All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes518Open in IMG/M
3300024235|Ga0228665_1045659All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes904Open in IMG/M
3300024242|Ga0228673_1063208All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes655Open in IMG/M
3300024242|Ga0228673_1098170All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes522Open in IMG/M
3300024244|Ga0228678_1090734All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes590Open in IMG/M
(restricted) 3300024255|Ga0233438_10288452All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes634Open in IMG/M
(restricted) 3300024264|Ga0233444_10107077All Organisms → Viruses → Predicted Viral1446Open in IMG/M
3300024266|Ga0228661_1016860All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1292Open in IMG/M
3300024291|Ga0228660_1012723Not Available1600Open in IMG/M
3300024291|Ga0228660_1030350All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Saprospiria → Saprospirales → unclassified Saprospirales → Saprospirales bacterium TMED2141023Open in IMG/M
3300024297|Ga0228658_1026809All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1490Open in IMG/M
3300024297|Ga0228658_1048144All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1087Open in IMG/M
3300024346|Ga0244775_10170177All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1835Open in IMG/M
3300025084|Ga0208298_1011920All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2100Open in IMG/M
3300025086|Ga0208157_1074785All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes857Open in IMG/M
3300025151|Ga0209645_1026995All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2138Open in IMG/M
3300025483|Ga0209557_1100579All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes596Open in IMG/M
3300025636|Ga0209136_1186726All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes516Open in IMG/M
3300025658|Ga0209659_1025023All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2436Open in IMG/M
3300025701|Ga0209771_1137083All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes768Open in IMG/M
3300025701|Ga0209771_1156679All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes695Open in IMG/M
3300025701|Ga0209771_1164229All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes671Open in IMG/M
3300025751|Ga0208150_1188929All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes639Open in IMG/M
3300025803|Ga0208425_1150115Not Available517Open in IMG/M
3300025830|Ga0209832_1209708All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes540Open in IMG/M
3300025840|Ga0208917_1054627Not Available1569Open in IMG/M
3300026077|Ga0208749_1040663All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes983Open in IMG/M
3300026136|Ga0208763_1007426All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1765Open in IMG/M
3300026201|Ga0208127_1113792All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes685Open in IMG/M
3300026447|Ga0247607_1013733All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1308Open in IMG/M
3300026470|Ga0247599_1038647All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1011Open in IMG/M
3300026503|Ga0247605_1080424Not Available803Open in IMG/M
3300027183|Ga0208798_1019936All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes788Open in IMG/M
3300027320|Ga0208923_1084375All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes562Open in IMG/M
3300027757|Ga0208671_10143788All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes868Open in IMG/M
3300028109|Ga0247582_1020133All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1641Open in IMG/M
3300028124|Ga0228621_1013706Not Available946Open in IMG/M
3300028128|Ga0228645_1038601All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes1063Open in IMG/M
3300028196|Ga0257114_1284653All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes576Open in IMG/M
3300031519|Ga0307488_10077410All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes2483Open in IMG/M
3300031676|Ga0302136_1200062All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes590Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SeawaterEnvironmental → Aquatic → Marine → Coastal → Unclassified → Seawater21.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine11.00%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous11.00%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh11.00%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine9.00%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine7.00%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater7.00%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.00%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water3.00%
Pond WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water3.00%
SeawaterEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Seawater2.00%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater2.00%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake1.00%
Surface SeawaterEnvironmental → Aquatic → Marine → Oceanic → Photic Zone → Surface Seawater1.00%
MarineEnvironmental → Aquatic → Marine → Oceanic → Oil-Contaminated → Marine1.00%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine1.00%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine1.00%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient1.00%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.00%
EstuarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine1.00%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine1.00%
SeawaterEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Seawater1.00%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2222084003Marine microbial communities from Deepwater Horizon oil blowout, Alabama, USA - Ctl_5_microcosmEnvironmentalOpen in IMG/M
3300002483Marine viral communities from the Pacific Ocean - ETNP_6_30EnvironmentalOpen in IMG/M
3300003216Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNAEnvironmentalOpen in IMG/M
3300004054Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MM15.SN (v2)EnvironmentalOpen in IMG/M
3300004279Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_10mEnvironmentalOpen in IMG/M
3300004448Marine viral communities from Newfoundland, Canada BC-1EnvironmentalOpen in IMG/M
3300005510Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45EnvironmentalOpen in IMG/M
3300006357Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006867Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_<0.8_DNAEnvironmentalOpen in IMG/M
3300006924Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaGEnvironmentalOpen in IMG/M
3300007344Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007541Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaGEnvironmentalOpen in IMG/M
3300007554Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.709EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300009000Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MGEnvironmentalOpen in IMG/M
3300009001Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MGEnvironmentalOpen in IMG/M
3300009002Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.573EnvironmentalOpen in IMG/M
3300009027Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_A_H2O_MGEnvironmentalOpen in IMG/M
3300009050Estuarine microbial communities from the Columbia River estuary - metaG 1557A-02EnvironmentalOpen in IMG/M
3300009059Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.703EnvironmentalOpen in IMG/M
3300009080Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759EnvironmentalOpen in IMG/M
3300012928Marine microbial communities from the Costa Rica Dome - CRUD Field 142mm St17 metaGEnvironmentalOpen in IMG/M
3300012952Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 4 MetagenomeEnvironmentalOpen in IMG/M
3300012953Marine eukaryotic phytoplankton communities from the Atlantic Ocean - Atlantic ANT 2 MetagenomeEnvironmentalOpen in IMG/M
3300016734Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 041410CS metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016737Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011506CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016749Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011512AT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016771Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300017697Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_DNA (version 2)EnvironmentalOpen in IMG/M
3300017714Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 35 SPOT_SRF_2012-08-15EnvironmentalOpen in IMG/M
3300017742Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 22 SPOT_SRF_2011-05-21EnvironmentalOpen in IMG/M
3300017746Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 12 SPOT_SRF_2010-06-29EnvironmentalOpen in IMG/M
3300017751Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 13 SPOT_SRF_2010-07-21 (version 2)EnvironmentalOpen in IMG/M
3300017760Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 31 SPOT_SRF_2012-02-16EnvironmentalOpen in IMG/M
3300017768Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 6 SPOT_SRF_2009-12-23 (version 2)EnvironmentalOpen in IMG/M
3300017779Marine viral communities from the oligotrophic San Pedro Time Series (SPOT) site, San Pedro Channel, CA, USA ? 18 SPOT_SRF_2010-12-16EnvironmentalOpen in IMG/M
3300017967Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018036Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 041406US metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018417Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011507BT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020175Pelagic subsurface seawater microbial communities from Kabeltonne, Helgoland, North Sea - Helgoland_Spring_Bloom_20160321_2EnvironmentalOpen in IMG/M
3300020442Marine microbial communities from Tara Oceans - TARA_B100002019 (ERX556121-ERR599162)EnvironmentalOpen in IMG/M
3300020457Marine microbial communities from Tara Oceans - TARA_B100001113 (ERX555941-ERR599014)EnvironmentalOpen in IMG/M
3300021368Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550EnvironmentalOpen in IMG/M
3300021373Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300021958Estuarine water microbial communities from San Francisco Bay, California, United States - C33_27DEnvironmentalOpen in IMG/M
3300021959Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13DEnvironmentalOpen in IMG/M
3300022187Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3)EnvironmentalOpen in IMG/M
3300023693Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 29R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023709Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501CT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024228Seawater microbial communities from Monterey Bay, California, United States - 41DEnvironmentalOpen in IMG/M
3300024230Seawater microbial communities from Monterey Bay, California, United States - 48DEnvironmentalOpen in IMG/M
3300024231Seawater microbial communities from Monterey Bay, California, United States - 43DEnvironmentalOpen in IMG/M
3300024235Seawater microbial communities from Monterey Bay, California, United States - 79DEnvironmentalOpen in IMG/M
3300024242Seawater microbial communities from Monterey Bay, California, United States - 91DEnvironmentalOpen in IMG/M
3300024244Seawater microbial communities from Monterey Bay, California, United States - 125D_rEnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024264 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_10_MGEnvironmentalOpen in IMG/M
3300024266Seawater microbial communities from Monterey Bay, California, United States - 75DEnvironmentalOpen in IMG/M
3300024291Seawater microbial communities from Monterey Bay, California, United States - 74DEnvironmentalOpen in IMG/M
3300024297Seawater microbial communities from Monterey Bay, California, United States - 71DEnvironmentalOpen in IMG/M
3300024346Whole water sample coassemblyEnvironmentalOpen in IMG/M
3300025084Marine viral communities from the Subarctic Pacific Ocean - 14B_ETSP_OMZ_AT15311_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025086Marine viral communities from the Subarctic Pacific Ocean - 5_ETSP_OMZ_AT15132 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025151Marine viral communities from the Pacific Ocean - ETNP_6_30 (SPAdes)EnvironmentalOpen in IMG/M
3300025483Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - Saanich Inlet SI074_LV_120m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025636Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_90LU_22_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025658Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI072_LV_10m_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025701Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_59LU_5_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025751Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025803Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_30_<0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025830Pelagic marine microbial communities from North Sea - COGITO_mtgs_110407 (SPAdes)EnvironmentalOpen in IMG/M
3300025840Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300026077Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_DCM_ad_63m_LV_B (SPAdes)EnvironmentalOpen in IMG/M
3300026136Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306PF45B (SPAdes)EnvironmentalOpen in IMG/M
3300026201Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201306SV45 (SPAdes)EnvironmentalOpen in IMG/M
3300026447Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 125R_r (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026470Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 73R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300026503Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 91R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300027183Estuarine microbial communities from the Columbia River estuary - Ebb tide non-ETM metaG S.571 (SPAdes)EnvironmentalOpen in IMG/M
3300027320Estuarine microbial communities from the Columbia River estuary - Freshwater metaG S.575 (SPAdes)EnvironmentalOpen in IMG/M
3300027753Estuarine microbial communities from the Columbia River estuary - Flood tide ETM metaG S.741 (SPAdes)EnvironmentalOpen in IMG/M
3300027757Estuarine microbial communities from the Columbia River estuary - Ebb tide ETM metaG S.759 (SPAdes)EnvironmentalOpen in IMG/M
3300028109Metatranscriptome of seawater microbial communities from Monterey Bay, California, United States - 41R (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028124Seawater microbial communities from Monterey Bay, California, United States - 25DEnvironmentalOpen in IMG/M
3300028128Seawater microbial communities from Monterey Bay, California, United States - 57DEnvironmentalOpen in IMG/M
3300028196Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI112_10mEnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031676Marine microbial communities from Western Arctic Ocean, Canada - CBN3_20mEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
22225181652222084003MarineMLRRPDSIPSGDTVITDPVLEPFFISKSSTGGYTVYERVIKGENNTEYIKTIAYPGNFGY
JGI25132J35274_107923823300002483MarineMLRNPNSIPETDTVIKDPVLDPFFITRSQSGGYTVFEQVVKGDNDTKYIKSLGYPSNFGSALNMVAREKLNEGGKFMI*
JGI26079J46598_104936443300003216MarineMLRNPNSIPDGDTIIQDPVMEPFFIAKSQSGGYTVYERVIKGENKTEYIKTVCYPSNFGGALKTVAREILNGDPTKK
Ga0063232_1001394013300004054Freshwater LakeMLRNPNTIPKEDIIIEDQAMEPFFISKAKSGAGGFTVFERVVKGENNTHYIRTVCYPSTFNGALRTVAKEL
Ga0066605_1027182913300004279MarineMLRKPNSIPSNDVTIKDPVMDPFFISRSQTGGYTVFENVIKGENNTEYIKTVCYPSNFQNALKA
Ga0065861_105271513300004448MarineMLRRPDSIPDGDTVIEDPVMEPFFIAKSSSGGYTVYERVIKGDNDTPYIKTICYPATFNHALKVVSRELLN
Ga0066825_1013978213300005510MarineMLRNPNSIPETDTVIKDPVLDPFFITRSQSGGYTVFEQVVKGDNDTKYIKSLGYPSNFGSAL
Ga0075502_154527933300006357AqueousMLRKPDSIPAGDTIIQDPVMEPFFITKSQTGGYTLYERVIKGDNNTEYIKTICYPGKFNYALKRVAIEKLNN
Ga0098048_122004423300006752MarineMLRRPDSIPAGDTVITDPALEPFFITRSNTGGFTLYERVIKGDNDTEYIKTVCYPSNFANALKKAAEE
Ga0075476_1021053913300006867AqueousMLRNPNSVPSSDTVIQDPVMEPFFITRSQTGGYTVYERVVKGDNDTEYIKSLGYPSTFG
Ga0098051_117757013300006924MarineMLRNPNSIPETDTVIKDPVLDPFFITRSQSGGFTVFENVVKGDNNTEYIKSLGYPSNFGSALNMIAREKLNEGGK
Ga0070745_128283733300007344AqueousMLRRPDSIPSGDTIIQDPIMEPFFISKSQTGGYTLYERVVKGENNTEYIKTVCYPGNFNYAL
Ga0070753_121757833300007346AqueousMLRNPNSVPSTDTVIQDPVMEPFFITRSQTGGYTVYERVVKGDKDTEYIKSLGYTSTFGSALKMVAK
Ga0099851_103060723300007538AqueousMLRRPDSIPDGDTVIEDPVMEPFFIAKSSSGGYTVYERVIKGENDTPYIKTICYPSTFANALKKVAKELVNAK*
Ga0099848_125742233300007541AqueousMLRRPDSIPVGDVIIQDPVMEPFFIAKSQSGGYTLYERVIKGDKDTEYIKTICYPGTFNHAL
Ga0102820_117147723300007554EstuarineMLRKPDSIPSNETIVEDPVMEPFFITRSQTGGYTVYERVIKGENNTAYIKTIGYPSNFGN
Ga0099850_117043743300007960AqueousMLRKPDSLSPSDTVIQDPAMEPFFITKSQAGGYVVYERVTKGEKNTEYIKTICYPSTFNYALKAVARERLNCTDKSQYNSLK
Ga0102960_115604813300009000Pond WaterMLRNPNSVPTTDTVIQDPVMEPFFITRSQTGGYTVYERVIKGDNDTEYIKSLGYPSTFGSALKMVAKEML
Ga0102963_106397813300009001Pond WaterMLRKPNSIPAGDTIIADPVMEPFFIARSQTGGYTVYERVVKGEKDTEYIKTISYPSTFGSALKTIANEILNEGGKTY
Ga0102810_100694313300009002EstuarineMLRRPDSIPAGDTVVQDPVMEPFFIAKSQSGGYTVYERVIKGEKNTEYIKTICYPSNFNGALKVVAR
Ga0102957_142137123300009027Pond WaterMLRKPDSIPAGDTIIQDPVMEPFFITRSQTGGFTVYERVVKGENNTEYIKTISYPSNFGNALQTVAREILN
Ga0102909_111573833300009050EstuarineMLRNPNTIPKEDIIIEDQAMEPFFISKAKSGAGGFTVFERVVKGENNTHYIRTVCYPSTFNGALRTVAKELLNS
Ga0102830_117521533300009059EstuarineMLRNPKSIPSGDTIIQDPVMEPFFISKSQSGGYTVYERVTKGEKNTEYIKTVSYPATFNSALKRVASELLNNSNNKQYNS
Ga0102815_1070602523300009080EstuarineMLRNPNSIPEGDTVIEDPVLEPFFISKSQSGGYTVYERVIKGENNTHYIKTVSYPSTFNGALKTIGREILNQGGKK
Ga0163110_1027956043300012928Surface SeawaterMLRNPDSIPAGDTIIKDPAMEPFFISKSQSGGYTVFERVIKGENNTEYIKTICYPSTFGGALKTIAKE
Ga0163180_1070545143300012952SeawaterMLRKPDSIPSNETIIEDPAMEPFFITRSQTGGYTVYERVVKGENDTPYIKTIGYPSNFGYALKSVAREILNE
Ga0163179_1052970513300012953SeawaterMLRNPNSIPASDTIIADPVMEPFFITRSPNNGYTVYERVVKGQNDTEYIKNVSYPSNFGNALKSVAREILNEEGKTYT
Ga0182092_116234913300016734Salt MarshMLRNPNSVPSTDTVIQDPVMEPFFITRSQTGGYTVYERVVKGEKDTEYIKSLGYPSTFGS
Ga0182092_120470733300016734Salt MarshMLRKPDSIPTGDTLIQDPVMEPFFVSKSQTGGYTVYERVVKGDNNTEYIKTVSYPSTFGSALK
Ga0182047_142824913300016737Salt MarshMLRKPDSIPAGDTLIQDPVMEPFFISKSQSGGYTVYERVVKGNNNTEYIKTVSYPATFNGALKRVANEKLN
Ga0182053_109358013300016749Salt MarshMLRKPDSIPAGDTLIQDPVMEPFFISKSQSGGYTVYERVVKGNNDTEYIKTVSYPATFNGALKR
Ga0182082_103982833300016771Salt MarshMLRNPNSIPTGDTIIQDPVMEPFFITRSQTGGYTVYERVIKGENNTEYIKTISYPSNFGYALKTVA
Ga0180120_1003586563300017697Freshwater To Marine Saline GradientMLRRPDSIPAGDTVIEDPVMEPFFIAKSSSGGYTVYERVIKGENDTPYIKTICYPATFNNALKVVCRELLNY
Ga0181412_113693313300017714SeawaterMLRKPDSIPANDTIIEDPSMEPFFISKSTTGGFTVYERVIKGENDTPYIKTICYPANF
Ga0181399_106620513300017742SeawaterMLRKPDSIPSSDTVITDPALEPFFICRSSTGGYTLFERVIKGDNNTEYIKTICYPSNFTFALKKASEELLNTNREFS
Ga0181389_114924013300017746SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNTEYIKTICYPSN
Ga0187219_109703333300017751SeawaterMLRKPDSIPSSDTVITDPALEPFFICRSSTGGYTLFERVVKGENDTEYIKTICYPSNFTNAL
Ga0181408_117998813300017760SeawaterMLRRPDSIPVGDTVIEDPIMEPFFIAKSASGGYTVYERVIKGENNTHYIKTICYPANFNYALKTVSREMLNNKSNH
Ga0187220_111863243300017768SeawaterMLRRPDSIPATDTVIEDPAMEPFFITNSASGGYTVYERVIKGENNTPYIKTICYPGNFTYALKKVAEE
Ga0181395_113790713300017779SeawaterMLRKPDSIPASDTVIEDPVLEPFFITRSPSGGFTLYERVIKGENNTEYIKTICYPSNFNFALKKASEE
Ga0181590_1030125913300017967Salt MarshMLRRPDSIPSGDTIIQDPVMEPFFISKSQSGGYTVYERVIKGENNTEYIKTICYPGTFNHALKSVAR
Ga0181590_1037135033300017967Salt MarshMLRNPDSIPSSDTIIQDPVMEPYFITRSQTGGYTVYERVVKGDNNTEYIKTLGYPSNFGNALRSVAREILNEE
Ga0181600_1023653613300018036Salt MarshMLRNPESIPASDTLIQDPVMEPFFITRSQTGGYTVYERVIKGDNDTEYIKNISYPSNFGNALKTIAREKLN
Ga0181558_1064263123300018417Salt MarshMLRKPDSIPAGDTLIQDPVMEPFFISKSQSGGYTVYERVVKGNNDTEYIKTVSYPATFNGALKRVANEKLNNGESKVYN
Ga0181568_1061646633300018428Salt MarshMLRTPDSIPAGDTVIQDPVMEPFFITKSQTGGYTLYERVIKGDNNTEYIKTICYHGKFNYALKRVAI
Ga0206124_1017602143300020175SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVVKGENNTEYIKTVCYPGNFGYALKTI
Ga0211559_1007287943300020442MarineMLRKPDSIPSNETIIEDPAMEPFFITRSQTGGYTVYERVVKGENDTPYIKTIGYPSTF
Ga0211643_1025341613300020457MarineMLRKPDSIPAGDTVIEDPVLEPFFITRSPSGGFTLYERVIKGENNTEYIKTICYPSNFNYALKKASEELLNTN
Ga0213860_1034036733300021368SeawaterMLRKPDSIPSTDTVIKDKAMEPFFIAKSSSGGYTVYENVIKGENNTPYIKTICYPASFSFALKKVAEELL
Ga0213865_1044864913300021373SeawaterMLRDPNSIPAGDTIIEDPALEPFFITRSQVGGYVVYERVTKGENNNEYLKTVGYPSTFNHALKM
Ga0222717_1056559613300021957Estuarine WaterMLRKPNSVPSSDTVIQDPVMEPFFITRSQTGGYTVYERVIKGDNDTEYIKTLGYPSKFGNALQMVAR
Ga0222718_1004711053300021958Estuarine WaterMLRNPNSIPSSDTIIQDPVMEPFFITRSQTGGYTVYERVVKGDNDTEYIKNISYPSNFGNAIKTIAREKLNE
Ga0222716_1028414813300021959Estuarine WaterMLRKPNSIPAKDVIIKDPAMEPFFISRSQTGGYTVFENVIKGENNTEYIKTVCYPSNFSNALKAVARELLNYSTGKE
Ga0196899_121499023300022187AqueousMLRRPDSIPDGDTVIEDPVMEPFFIAKSSSGGYTVYERVIKGDNDTPYIKTICYPATFNHALKV
Ga0232112_101060313300023693SeawaterMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKGENNTEYIKTVCYPANFSYALKKVAEEKLNTKK
Ga0232122_105599443300023709Salt MarshMLRKPDSIPAGDTLIQDPVMEPFFISKSQSGGYTVYERVVKGNNDTEYIKTVSYPATFNGALKRVANEKLNNG
Ga0228633_108974833300024228SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVVKGEKNTEYIKTVCYPGNFGYALKVIAEEKT
Ga0228638_107861433300024230SeawaterMLRKPDSIPSNETIVEDPVMEPFFITRSQTGGYTVYERVIKGENKTAYIKTIGYPSNFGNALKCVAR
Ga0233399_114162023300024231SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNTEYIKTICYPSNFSNALKKAAEEI
Ga0228665_104565933300024235SeawaterMLRKPDSIPANDTIVQDPSMEPFFISKSSTGGYTVYERVIKGENNTEYIKTVCYPANFSYALKKVAEEKLNT
Ga0228673_106320813300024242SeawaterMLRRPDSIPAGDTVITDPALEPFFITRSNTGGFTLYERVIKGDNDTEYIKTVCYPSNF
Ga0228673_109817023300024242SeawaterMLRNPNSIPATDTIIADPVMEPFFITRSPNNGYTVYERVVKGENNTEYIKTVSYPSNFGNALRSVARE
Ga0228678_109073433300024244SeawaterMLRKPDSIPSGDTIIQDPVMEPFFITRSQSGGYTVYERVVKGENNTEYIKTICYPGNFNFALKTIATEKLNSGEKTIYSSLKD
(restricted) Ga0233438_1028845213300024255SeawaterMLRRPDSIPDGDTVIEDSVMEPFFIAKSSSGGYTVYERVIKGENDTHYIKTICYPGNFNAALKAVCR
(restricted) Ga0233444_1010707743300024264SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVIKGENNTEYIKTVCYPGNFGYALKTIAEEKTNHNRNYST
Ga0228661_101686043300024266SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGENNTEYIKTICYPSNFSNALKKAA
Ga0228660_101272313300024291SeawaterMLRRPDSIPNGDTIISDPILEPFFISKSSTGGYTVYERVVKGENNTEYIKTVCYPGNFGYALKAIV
Ga0228660_103035043300024291SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVVKGEKNTEYIKTVCYPGNFGYALKVIAEEKTNLSKNYS
Ga0228658_102680943300024297SeawaterMLRKPDSIPSSDTVITDPALEPFFICRSSTGGYTLFERVIKGDNNTEYIKTICYPSNFTFALKKASEELL
Ga0228658_104814413300024297SeawaterMLRNPDSIPAGDTIVKDPAMEPFFISKSQSGGYTVFERVVKGENKTEYIKTISYPSTFGGALKTVAKELLNSDPEKKEYS
Ga0244775_1017017713300024346EstuarineMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNTEYIKTICYPSNFSNALKKAAEEILNTGKDY
Ga0208298_101192013300025084MarineMLRRPDSIPAGDTIIEDSVMEPFFIAKSSSGGYTVYERVIKGDNNTHYIKTICYPGNFNHALKAVCRELLNNK
Ga0208157_107478543300025086MarineMLRNPNSIPETDTVIKDPVLDPFFITRSQTGGYTVYERVVKGDNNTEYIKTLGYPSNFGNALRS
Ga0209645_102699513300025151MarineMLRRPDSIPATDTVIEDPAMEPFFITNSSSGGYTVYERVIKGENNTPYIKTVCYPGNFSYAL
Ga0209557_110057933300025483MarineMLRRPDSIPAGDTVVQDPVMEPFFIAKSQSGGYTVYERVIKGEKNTEYIKTICYPSNFNGALKVVAREKLNSGTQKVYNS
Ga0209136_118672623300025636MarineMLRNPNSIPSTDTIIADPVMEPFFITRSPNNGYTVYERVIKGDNDTEYIKNISYPSNFGNALRTIAREKLNVEGKTY
Ga0209659_102502313300025658MarineMLRRPDSIPAGDTIIEDAVMEPFFIAKSTSGGYTLYERVIKGENNTHYIKTVCYPATFNQALKSACRELLNSKSK
Ga0209771_113708343300025701MarineMLRKPDSIPSTDTIVKDPVMEPFFISKSASGGFTVYERVIKGDNDTPYIKTVSYPGNFGAALKTVAR
Ga0209771_115667933300025701MarineMLRNPDSVPASDTIIADPVMEPFFITRSQTGGYTVYERVVKGENNTEYIKTLGYPSNFGNALRSVAREI
Ga0209771_116422913300025701MarineMLRNPDSIPSSDTVIQDPVMEPFFITRSQTGGYTVYERVVKGENNTSYIKTLGYPSNFGGALKMVANELLNEGGK
Ga0208150_118892913300025751AqueousMLRNPDSIPAGDTIVKDPAMEPFFISKSQSGGYTVFERVVKGENQTEYIKTISYPSTFGGALKTVAKELLNSD
Ga0208425_115011513300025803AqueousMLRRPDSIPSTDTIISDAILEPFFISKSSTGGFTVYERVTKGENNTQYIKTVCYPGNFGYALKVIAE
Ga0209832_120970813300025830Pelagic MarineMLRNPNSIPAGDILIQDPVMEPFFITKSQSGGYTVYERVEKGENNTKYIKTINYPSTFNQALLKVSNELLNYGEVTTFNTI
Ga0208917_105462763300025840AqueousMLRKPNSIPSSDTVITDDAFGPFFITRSSTGGYTVYENVIKGENKTKYIKTICYPSR
Ga0208749_104066343300026077MarineMLRNPDSIPAGDTIIKDPAMEPFFISKSQSGGYTVFERVIKGENNTEYIKTICYPSTFGGALKTIAKEILDSFFSNSINLFLTP
Ga0208763_100742613300026136MarineMLRNPNSIPETDTVIKDPVLDPFFITRSQSGGYTVFEQVVKGDNDTKYIKSLGYPSNFGSALNMVAREKLNEGGKI
Ga0208127_111379233300026201MarineMLRNPNSIPETDTVIKDPVLDPFFITRSQSGGYTVFEQVVKGDNDTKYIKSLGYPSNFGSALNMV
Ga0247607_101373323300026447SeawaterMLRNPNSIPATDTIIADPVMEPFFITRSPNNGYTVYERVVKGENNTEYIKTVSYPSNFGNALRSVAREKLRRRSYL
Ga0247599_103864713300026470SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNTEYIKTICYPSNFSNALKKAAEEILNT
Ga0247605_108042423300026503SeawaterMLRRPDSIPSTDTIISDPVLEPFFISKSSTGGFTVYERVTKGENNTEYIKTVCYPGNFGYALKTIAEEKN
Ga0208798_101993613300027183EstuarineMLRRPDSIPAGDTVVQDPVMEPFFIAKSQSGGYTVYERVIKGEKNTEYIKTICYPSNFNGALKVVD
Ga0208923_108437523300027320EstuarineMLRNPDSIPAGDTIIKDPAMEPFFISKSQSGGYTVFERVVKGENQTEYIKTISYPSNFGGALKTVAKELLNGDPVKKEYS
Ga0208305_1025684933300027753EstuarineMLRNPNTIPKEDIIIEDQAMEPFFISKAKSGAGGFTVFERVVKGENNTHYIRTVCYPSTFNGALRTVAKELLN
Ga0208671_1014378813300027757EstuarineMLRNPDSVPASDTLIQDPVMEPYFITRSQTGGFTVYERVIKGDNDTPYIKTVSYPGNFGAALKTVARELLNGDPNKK
Ga0247582_102013333300028109SeawaterMLRKPDSIPSGDTIIQDPVMEPFFITRSQSGGYTVYERVVKGENNTEYIKTICYPGNFNFALKTIATEKLNSGEKNYL
Ga0228621_101370643300028124SeawaterMLRRPDSIPNGDTIISDPILEPFFISKSSTGGYTVYERVVKGENNTEYIKTVCYPGNFGY
Ga0228645_103860113300028128SeawaterMLRKPDSISASDTVITDPALEPFFVSRSQTGGYTLYERVIKGDNNTEYIKTICYPSNFSNALK
Ga0257114_128465323300028196MarineMLRRPDSIPAGDTIIEDAVMEPFFIAKSTSGGYTLYERVIKGENNTHYIKTVCYPATFNQAL
Ga0307488_1007741053300031519Sackhole BrineMLRNPNSIPSGDTVIQDKVMEPFFIAKSQSGGYTVYERVIKGENKTEYIKTISYPSNFNAALKTV
Ga0302136_120006213300031676MarineMLRKPDSIPAGDTVIIDPVMEPFFIAKSQSGGYTVYERVIKGENNTEYIKTICYPATFNHALKT

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.