Basic Information | |
---|---|
Family ID | F105442 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 38 residues |
Representative Sequence | MRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS |
Number of Associated Samples | 82 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 44.33 % |
% of genes near scaffold ends (potentially truncated) | 18.00 % |
% of genes from short scaffolds (< 2000 bps) | 79.00 % |
Associated GOLD sequencing projects | 80 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.53 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (88.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (25.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (28.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Host-associated → Plant → Plant rhizosphere (42.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 45.31% β-sheet: 0.00% Coil/Unstructured: 54.69% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.53 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF05437 | AzlD | 47.00 |
PF03591 | AzlC | 8.00 |
PF00293 | NUDIX | 8.00 |
PF08338 | DUF1731 | 4.00 |
PF01370 | Epimerase | 4.00 |
PF02445 | NadA | 2.00 |
PF13460 | NAD_binding_10 | 2.00 |
PF00890 | FAD_binding_2 | 2.00 |
PF02749 | QRPTase_N | 1.00 |
PF02511 | Thy1 | 1.00 |
PF02872 | 5_nucleotid_C | 1.00 |
PF02910 | Succ_DH_flav_C | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG1296 | Predicted branched-chain amino acid permease (azaleucine resistance) | Amino acid transport and metabolism [E] | 8.00 |
COG1090 | NAD dependent epimerase/dehydratase family enzyme | General function prediction only [R] | 4.00 |
COG0379 | Quinolinate synthase | Coenzyme transport and metabolism [H] | 2.00 |
COG0157 | Nicotinate-nucleotide pyrophosphorylase | Coenzyme transport and metabolism [H] | 1.00 |
COG0737 | 2',3'-cyclic-nucleotide 2'-phosphodiesterase/5'- or 3'-nucleotidase, 5'-nucleotidase family | Defense mechanisms [V] | 1.00 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 1.00 |
COG1488 | Nicotinic acid phosphoribosyltransferase | Coenzyme transport and metabolism [H] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 88.00 % |
Unclassified | root | N/A | 12.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000033|ICChiseqgaiiDRAFT_c0802188 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1003 | Open in IMG/M |
3300000956|JGI10216J12902_101738276 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 684 | Open in IMG/M |
3300000956|JGI10216J12902_108835973 | All Organisms → cellular organisms → Bacteria | 1669 | Open in IMG/M |
3300000956|JGI10216J12902_113269126 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1045 | Open in IMG/M |
3300003993|Ga0055468_10117154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 766 | Open in IMG/M |
3300004156|Ga0062589_100745054 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 878 | Open in IMG/M |
3300005577|Ga0068857_100058493 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 3423 | Open in IMG/M |
3300005713|Ga0066905_100089599 | All Organisms → cellular organisms → Bacteria | 2052 | Open in IMG/M |
3300005713|Ga0066905_101548370 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300005719|Ga0068861_101916514 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 590 | Open in IMG/M |
3300005937|Ga0081455_10029094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5040 | Open in IMG/M |
3300005937|Ga0081455_10793240 | All Organisms → cellular organisms → Bacteria | 595 | Open in IMG/M |
3300006224|Ga0079037_100374234 | All Organisms → cellular organisms → Bacteria | 1342 | Open in IMG/M |
3300006844|Ga0075428_100275635 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1810 | Open in IMG/M |
3300006845|Ga0075421_101739874 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 673 | Open in IMG/M |
3300006846|Ga0075430_100691283 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 841 | Open in IMG/M |
3300006852|Ga0075433_10283052 | All Organisms → cellular organisms → Bacteria | 1469 | Open in IMG/M |
3300006852|Ga0075433_10328128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1353 | Open in IMG/M |
3300006876|Ga0079217_10481516 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 765 | Open in IMG/M |
3300006876|Ga0079217_11515101 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 531 | Open in IMG/M |
3300009146|Ga0105091_10535849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 598 | Open in IMG/M |
3300009147|Ga0114129_11458997 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 842 | Open in IMG/M |
3300009156|Ga0111538_13975078 | Not Available | 511 | Open in IMG/M |
3300009162|Ga0075423_10939079 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 918 | Open in IMG/M |
3300009176|Ga0105242_12790411 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 539 | Open in IMG/M |
3300009553|Ga0105249_10904778 | All Organisms → cellular organisms → Bacteria | 949 | Open in IMG/M |
3300010401|Ga0134121_10332500 | All Organisms → cellular organisms → Bacteria | 1354 | Open in IMG/M |
3300012530|Ga0136635_10010873 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 2741 | Open in IMG/M |
3300012897|Ga0157285_10017282 | All Organisms → cellular organisms → Bacteria | 1494 | Open in IMG/M |
3300012905|Ga0157296_10096556 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 799 | Open in IMG/M |
3300012951|Ga0164300_10196222 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 985 | Open in IMG/M |
3300014265|Ga0075314_1019754 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1203 | Open in IMG/M |
3300014267|Ga0075313_1028728 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1272 | Open in IMG/M |
3300014321|Ga0075353_1093759 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 692 | Open in IMG/M |
3300014745|Ga0157377_10206201 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1251 | Open in IMG/M |
3300014969|Ga0157376_10625753 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 1074 | Open in IMG/M |
3300015200|Ga0173480_10056373 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1784 | Open in IMG/M |
3300015371|Ga0132258_10113787 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 6413 | Open in IMG/M |
3300015371|Ga0132258_10277526 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 4111 | Open in IMG/M |
3300015371|Ga0132258_11071501 | All Organisms → cellular organisms → Bacteria | 2037 | Open in IMG/M |
3300015371|Ga0132258_12000613 | All Organisms → cellular organisms → Bacteria | 1458 | Open in IMG/M |
3300015372|Ga0132256_101790226 | Not Available | 722 | Open in IMG/M |
3300015372|Ga0132256_102409093 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 629 | Open in IMG/M |
3300015373|Ga0132257_100787616 | All Organisms → cellular organisms → Bacteria | 1186 | Open in IMG/M |
3300015374|Ga0132255_100043890 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 5770 | Open in IMG/M |
3300017965|Ga0190266_10066355 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 1350 | Open in IMG/M |
3300018066|Ga0184617_1087847 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 852 | Open in IMG/M |
3300018073|Ga0184624_10014374 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 2836 | Open in IMG/M |
3300018073|Ga0184624_10160030 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 993 | Open in IMG/M |
3300018082|Ga0184639_10246095 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 945 | Open in IMG/M |
3300018083|Ga0184628_10651828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 528 | Open in IMG/M |
3300018422|Ga0190265_10048681 | All Organisms → cellular organisms → Bacteria | 3677 | Open in IMG/M |
3300018432|Ga0190275_10023471 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia | 4831 | Open in IMG/M |
3300018466|Ga0190268_12316204 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 507 | Open in IMG/M |
3300018469|Ga0190270_10021860 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 3971 | Open in IMG/M |
3300018469|Ga0190270_10060185 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptomycetales → Streptomycetaceae → Streptomyces | 2700 | Open in IMG/M |
3300018469|Ga0190270_10164865 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1822 | Open in IMG/M |
3300018469|Ga0190270_10437740 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1224 | Open in IMG/M |
3300018469|Ga0190270_10581601 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales → unclassified Solirubrobacterales → Solirubrobacterales bacterium URHD0059 | 1087 | Open in IMG/M |
3300018481|Ga0190271_11172620 | Not Available | 891 | Open in IMG/M |
3300019356|Ga0173481_10031310 | All Organisms → cellular organisms → Bacteria | 1709 | Open in IMG/M |
3300019356|Ga0173481_10808154 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 519 | Open in IMG/M |
3300019361|Ga0173482_10195740 | All Organisms → cellular organisms → Bacteria | 824 | Open in IMG/M |
3300019487|Ga0187893_10794898 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 575 | Open in IMG/M |
3300019884|Ga0193741_1096027 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 759 | Open in IMG/M |
3300021329|Ga0210362_1624568 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 8549 | Open in IMG/M |
3300022214|Ga0224505_10381098 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 534 | Open in IMG/M |
3300022898|Ga0247745_1040984 | Not Available | 713 | Open in IMG/M |
3300025313|Ga0209431_11137646 | All Organisms → cellular organisms → Bacteria | 539 | Open in IMG/M |
3300025326|Ga0209342_11227877 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 550 | Open in IMG/M |
3300025538|Ga0210132_1017828 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 978 | Open in IMG/M |
3300025551|Ga0210131_1003591 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1855 | Open in IMG/M |
3300025567|Ga0210076_1009889 | All Organisms → cellular organisms → Bacteria | 2060 | Open in IMG/M |
3300025901|Ga0207688_11006484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 527 | Open in IMG/M |
3300025907|Ga0207645_10084981 | All Organisms → cellular organisms → Bacteria | 2031 | Open in IMG/M |
3300025908|Ga0207643_10009094 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Thermoleophilia → Solirubrobacterales | 5335 | Open in IMG/M |
3300025908|Ga0207643_10740418 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 636 | Open in IMG/M |
3300025910|Ga0207684_11397663 | Not Available | 573 | Open in IMG/M |
3300025931|Ga0207644_11734222 | Not Available | 523 | Open in IMG/M |
3300026062|Ga0208654_1009821 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1208 | Open in IMG/M |
3300027831|Ga0209797_10290227 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 681 | Open in IMG/M |
3300027843|Ga0209798_10340458 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 711 | Open in IMG/M |
3300027880|Ga0209481_10493340 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 632 | Open in IMG/M |
3300027886|Ga0209486_10151312 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1278 | Open in IMG/M |
3300027897|Ga0209254_10242805 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1412 | Open in IMG/M |
3300027907|Ga0207428_10345582 | All Organisms → cellular organisms → Bacteria | 1095 | Open in IMG/M |
3300028755|Ga0307316_10160239 | Not Available | 804 | Open in IMG/M |
3300028802|Ga0307503_10206168 | All Organisms → cellular organisms → Bacteria | 934 | Open in IMG/M |
3300028819|Ga0307296_10540238 | Not Available | 638 | Open in IMG/M |
3300028828|Ga0307312_10259484 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1126 | Open in IMG/M |
3300028876|Ga0307286_10203995 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 718 | Open in IMG/M |
3300028878|Ga0307278_10032006 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2404 | Open in IMG/M |
3300030336|Ga0247826_10621577 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 831 | Open in IMG/M |
3300030336|Ga0247826_11774964 | Not Available | 505 | Open in IMG/M |
3300030620|Ga0302046_10429675 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1084 | Open in IMG/M |
3300031229|Ga0299913_10629485 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1054 | Open in IMG/M |
3300033550|Ga0247829_10659156 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 871 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 25.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 10.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere | 6.00% |
Groundwater Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment | 5.00% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 4.00% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 4.00% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 3.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 3.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Unclassified → Soil | 3.00% |
Wetland Sediment | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment | 2.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 2.00% |
Tabebuia Heterophylla Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Tabebuia Heterophylla Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 2.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 2.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 2.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 1.00% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 1.00% |
Freshwater Wetlands | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Freshwater Wetlands | 1.00% |
Polar Desert Sand | Environmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand | 1.00% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 1.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Microbial Mat On Rocks | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Microbial Mat On Rocks | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000033 | Soil microbial communities from Great Prairies - Iowa, Continuous Corn soil | Environmental | Open in IMG/M |
3300000956 | Soil microbial communities from Great Prairies - Kansas, Native Prairie soil | Environmental | Open in IMG/M |
3300003993 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailC_D2 | Environmental | Open in IMG/M |
3300004156 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 1 | Environmental | Open in IMG/M |
3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Host-Associated | Open in IMG/M |
3300006224 | Freshwater wetland microbial communities from Ohio, USA, analyzing the effect of biotic and abiotic controls - Mud 3 Core 4 Depth 4 metaG | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006845 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 | Host-Associated | Open in IMG/M |
3300006846 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Host-Associated | Open in IMG/M |
3300006852 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Host-Associated | Open in IMG/M |
3300006876 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC AS200 | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300010401 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1 | Environmental | Open in IMG/M |
3300012530 | Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ85 (21.06) | Environmental | Open in IMG/M |
3300012897 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S074-202C-1 | Environmental | Open in IMG/M |
3300012905 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S013-104B-2 | Environmental | Open in IMG/M |
3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
3300014265 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D2 | Environmental | Open in IMG/M |
3300014267 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 | Environmental | Open in IMG/M |
3300014321 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_TuleB_D1 | Environmental | Open in IMG/M |
3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Host-Associated | Open in IMG/M |
3300015200 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S209-509C-1 (version 2) | Environmental | Open in IMG/M |
3300015371 | Combined assembly of cpr5 and col0 rhizosphere and soil | Host-Associated | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300015373 | Combined assembly of cpr5 rhizosphere | Host-Associated | Open in IMG/M |
3300015374 | Col-0 rhizosphere combined assembly | Host-Associated | Open in IMG/M |
3300017965 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 220 T | Environmental | Open in IMG/M |
3300018066 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_5_b1 | Environmental | Open in IMG/M |
3300018073 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1 | Environmental | Open in IMG/M |
3300018082 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3-1_170_b2 | Environmental | Open in IMG/M |
3300018083 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_b1 | Environmental | Open in IMG/M |
3300018422 | Populus adjacent soil microbial communities from riparian zone of Indian Creek, Utah, USA - 124 T | Environmental | Open in IMG/M |
3300018432 | Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 T | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018469 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 T | Environmental | Open in IMG/M |
3300018481 | Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 356 T | Environmental | Open in IMG/M |
3300019356 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S073-202C-2 (version 2) | Environmental | Open in IMG/M |
3300019361 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S133-311R-2 (version 2) | Environmental | Open in IMG/M |
3300019487 | White microbial mat communities from a basaltic lava cave in the Kipuka Kanohina Cave System on the Island of Hawaii, USA - MA170107-4 metaG | Environmental | Open in IMG/M |
3300019884 | Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2 | Environmental | Open in IMG/M |
3300021329 | Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Oregon, United States ? S.625 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022213 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Oct11_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022214 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022309 | Sediment microbial communities from San Francisco Bay, California, United States - SF_May12_sed_USGS_4_1 | Environmental | Open in IMG/M |
3300022898 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5 | Environmental | Open in IMG/M |
3300025313 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes) | Environmental | Open in IMG/M |
3300025325 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes) | Environmental | Open in IMG/M |
3300025326 | Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_2 (SPAdes) | Environmental | Open in IMG/M |
3300025538 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleC_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025551 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025567 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailA_D2 (SPAdes) | Environmental | Open in IMG/M |
3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) | Host-Associated | Open in IMG/M |
3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026062 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300027831 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T0Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027843 | Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes) | Environmental | Open in IMG/M |
3300027880 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes) | Host-Associated | Open in IMG/M |
3300027886 | Agricultural soil microbial communities from Utah to study Nitrogen management - NC Compost (SPAdes) | Environmental | Open in IMG/M |
3300027897 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - DIP11 DI (SPAdes) | Environmental | Open in IMG/M |
3300027907 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) | Host-Associated | Open in IMG/M |
3300028755 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356 | Environmental | Open in IMG/M |
3300028802 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_S | Environmental | Open in IMG/M |
3300028819 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153 | Environmental | Open in IMG/M |
3300028828 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202 | Environmental | Open in IMG/M |
3300028876 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140 | Environmental | Open in IMG/M |
3300028878 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117 | Environmental | Open in IMG/M |
3300030336 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day1 | Environmental | Open in IMG/M |
3300030620 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT147D111 | Environmental | Open in IMG/M |
3300031229 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38 | Environmental | Open in IMG/M |
3300033550 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
ICChiseqgaiiDRAFT_08021883 | 3300000033 | Soil | MRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS* |
JGI10216J12902_1017382761 | 3300000956 | Soil | MRHFRQWLLLVALASLVAEAIAAAAVFWHGGTPARRTG* |
JGI10216J12902_1088359731 | 3300000956 | Soil | WLLVIGLASLVAEAAAAAAVFWHRETPLRRSSSS* |
JGI10216J12902_1132691262 | 3300000956 | Soil | MRHFRLWLLVIALASLVAEAIAAVAVFWRGTPARRAS* |
Ga0055468_101171542 | 3300003993 | Natural And Restored Wetlands | MRHFRLWLLAIGALSVVAEAIAAAAVFWRGGLPAARRFRARS* |
Ga0062589_1007450541 | 3300004156 | Soil | QVDHCGMRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS* |
Ga0068857_1000584932 | 3300005577 | Corn Rhizosphere | MRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS* |
Ga0066905_1000895993 | 3300005713 | Tropical Forest Soil | MRHFRQWLLVIALASLVAEAIAAAAVFWHGGGQARRAG* |
Ga0066905_1015483702 | 3300005713 | Tropical Forest Soil | MRHFRMVLVVIGLASLVAEAIAAAAVFWHGGAPRRG* |
Ga0068861_1019165142 | 3300005719 | Switchgrass Rhizosphere | MRHFRQWLLVIALAGLVAEAIAAAAVFWHGQGSARRAG* |
Ga0081455_100290945 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRHFRLWLLVIGLLSLAAEALAAAAVFWRGAAKPTGEH* |
Ga0081455_107932402 | 3300005937 | Tabebuia Heterophylla Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGGAPSRRVS* |
Ga0079037_1003742342 | 3300006224 | Freshwater Wetlands | MRHFRLWLLTIGLLSLAAEAAAAAAVFWRGSAQRGPS* |
Ga0075428_1002756352 | 3300006844 | Populus Rhizosphere | MRHFRTWLLVIGLASLVAEAAAAAAVFWRGGAPARRS* |
Ga0075421_1017398742 | 3300006845 | Populus Rhizosphere | MRHLRTWLLVIGLASLVAEAAAAAAVFWHGGAPERRSGS* |
Ga0075430_1006912832 | 3300006846 | Populus Rhizosphere | MRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS* |
Ga0075433_102830523 | 3300006852 | Populus Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG* |
Ga0075433_103281283 | 3300006852 | Populus Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGGSPARRAG* |
Ga0079217_104815161 | 3300006876 | Agricultural Soil | TRPIRWRMRHFRTWLRVIGLASLLAEAAAAAAVFWRAGTPLRRP* |
Ga0079217_115151011 | 3300006876 | Agricultural Soil | FRTWLLVIGVVSLVAEVAAAAAVFWHGGTPLRRS* |
Ga0105091_105358491 | 3300009146 | Freshwater Sediment | MRHFRNWLLVIGLVSLAAEALAAAAVFWPGGAPLRR |
Ga0114129_114589973 | 3300009147 | Populus Rhizosphere | RHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS* |
Ga0111538_139750783 | 3300009156 | Populus Rhizosphere | MRHFRLWLLAIGLASLVAEGIAAAAVFWHGGAPRRS* |
Ga0075423_109390792 | 3300009162 | Populus Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGGSPARRVG* |
Ga0105242_127904112 | 3300009176 | Miscanthus Rhizosphere | MRHFRQWLLVIGLASLVAEAIAAAAVFWHGGHQARRSG* |
Ga0105249_109047782 | 3300009553 | Switchgrass Rhizosphere | MRHFRSWLLVIGLASLLAEAIAAAAVFWHGGAPRRS* |
Ga0134121_103325003 | 3300010401 | Terrestrial Soil | MRHFRSWLLVIGLASLVAEAIEAAAVFWHGGAPRRS* |
Ga0136635_100108733 | 3300012530 | Polar Desert Sand | MRHFRNWLLVIGLVSLAAEALAAAAVFWHGGTPLRRS* |
Ga0157285_100172822 | 3300012897 | Soil | MRHFRFWLLVIGLASLVAEAIAAAAVFWHGGAPRRS* |
Ga0157296_100965563 | 3300012905 | Soil | MRHFRLWLLLIGLASLVAEAIAAAAVFWHGGAPRRS* |
Ga0164300_101962222 | 3300012951 | Soil | MVDYWPMRHFRQWLLVIALASLVAEAIAAAAVFWHGPGSARRAG* |
Ga0075314_10197542 | 3300014265 | Natural And Restored Wetlands | MRHFRLWLLAIGALSVVAEAIAAAAVFWRGGLPATRRFRAPS* |
Ga0075313_10287282 | 3300014267 | Natural And Restored Wetlands | MRHFRTWLLLIGLVSLVAEAAAAAAVFWHGGTPLRRSQS* |
Ga0075353_10937592 | 3300014321 | Natural And Restored Wetlands | MQHFRLWLLFVGVLSLAAEAVAAAAVFWRGHAGRRSAN* |
Ga0157377_102062011 | 3300014745 | Miscanthus Rhizosphere | CGMRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS* |
Ga0157376_106257531 | 3300014969 | Miscanthus Rhizosphere | MRHFRLWLLAIGLVSLVAEAIAAAAVFWHGGAPRRS* |
Ga0173480_100563734 | 3300015200 | Soil | MRHFRLWLLVIGLASLLAEAIAAAAVFWHGGAPRRS* |
Ga0132258_101137875 | 3300015371 | Arabidopsis Rhizosphere | MRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGSPRRS* |
Ga0132258_102775262 | 3300015371 | Arabidopsis Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGGRPARRAG* |
Ga0132258_110715014 | 3300015371 | Arabidopsis Rhizosphere | MRHFRQWLFVIALASLVAEAIAAAAVFWHGGRPARRAG* |
Ga0132258_120006133 | 3300015371 | Arabidopsis Rhizosphere | MVDYWPMRHFRQWLLVIASAISVAEAIASAAVFWLGQGSARRAG |
Ga0132256_1017902261 | 3300015372 | Arabidopsis Rhizosphere | MVDYWPMRHFRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG* |
Ga0132256_1024090932 | 3300015372 | Arabidopsis Rhizosphere | MRHIRQWLLVIGLASLVAEAIAAAAVFWHGGYPARRSS* |
Ga0132257_1007876162 | 3300015373 | Arabidopsis Rhizosphere | MVDYWPMRHLRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG* |
Ga0132255_1000438905 | 3300015374 | Arabidopsis Rhizosphere | MRHFRQWLLVIGLASLVAEAIAAAAVFWHGGHAARRSG* |
Ga0190266_100663552 | 3300017965 | Soil | MRHFRNWLLVIGLVSLAAEALAAAAVFWHGGTPLRRS |
Ga0184617_10878472 | 3300018066 | Groundwater Sediment | MRHFKNWLLVIGLASLVAEAIAAAAVFWRGATQTSRP |
Ga0184624_100143743 | 3300018073 | Groundwater Sediment | MRHFRTWLLVIGLASLVAEAIAAAAVFWRGAANAHRS |
Ga0184624_101600302 | 3300018073 | Groundwater Sediment | MRHFRQWMLVIGLASLVAEAIAAAAVFWHGGTPVRRS |
Ga0184639_102460952 | 3300018082 | Groundwater Sediment | MRHFRLWLLTIGVLSLAAEALAAAAVFWGGTARRAQS |
Ga0184628_106518281 | 3300018083 | Groundwater Sediment | MRHFRQWLLVIGLASLVAEAIAAAAVFWHGGTPARRS |
Ga0190265_100486816 | 3300018422 | Soil | MRHFRRWLLAIGLLSLVAEAVGAAAVFWRGASRQPGAH |
Ga0190275_100234714 | 3300018432 | Soil | MGSRMRHFRTWLLVIGLASLVAEAAAAAAVFWHRETPLRRSS |
Ga0190268_123162042 | 3300018466 | Soil | MRHFRNWLLVIGLVSLAAEALAAAAVFWHGGTPLRRP |
Ga0190270_100218603 | 3300018469 | Soil | MRQFRTWLILIGLASLVAQAAAAAAVFWHGGTPMRRS |
Ga0190270_100601852 | 3300018469 | Soil | MRHFRTWLLLIGLASLVAQAAAAAAVFWHGGAPLRRS |
Ga0190270_101648654 | 3300018469 | Soil | MRHFRTWLLVIGLASLVAEAAAAAAVFWHGGSPARRSGS |
Ga0190270_104377403 | 3300018469 | Soil | GMRHFRTWLLVIGLASLVAEAAAAAAVFWHGGAPARRSGS |
Ga0190270_105816011 | 3300018469 | Soil | CRMRHFRTWLLVIGVVSLVAEAAAAAAVFWHGGTPLRRS |
Ga0190271_111726202 | 3300018481 | Soil | MRHFRLWLLVIGVASLAAEAVGAAAVFWRASPRRASGA |
Ga0173481_100313102 | 3300019356 | Soil | MRHFRQWMLVIGLASLVAEAIAAAAVFWHGGTPARRS |
Ga0173481_108081542 | 3300019356 | Soil | MRHFRLWLLVIGLASLLAEAIAAAAVFWHGGAPRRS |
Ga0173482_101957402 | 3300019361 | Soil | MRHFRQWLLVIGLASLVAEAIAAAAVFWHGGHAARRSG |
Ga0187893_107948982 | 3300019487 | Microbial Mat On Rocks | MRHFKTFLLAIGLVSLAAEAIAAAAVFWHGGSPLRRS |
Ga0193741_10960272 | 3300019884 | Soil | MRHMRTWLLVIGLASLVVEAAAAAAVFWRGGAPARRS |
Ga0210362_16245688 | 3300021329 | Estuarine | MRHFRLWLLVIGVMSLTAEAIAAAAVFWRGSSPVRGPDGF |
Ga0224500_100309153 | 3300022213 | Sediment | MRHFHLWLLMIGALSLAAEAIAAAAFFWRGDFPSRRFGTPRH |
Ga0224505_103810981 | 3300022214 | Sediment | MRHFRLWILAIGLVSLAAEAAAAAAVFWRGPEQRGGS |
Ga0224510_103370703 | 3300022309 | Sediment | MRHFHLWLLMIGALSLAAEAIAAAAFFWRGGFPSRRFGTPRH |
Ga0247745_10409843 | 3300022898 | Soil | MRHFRSWLLVIGLASLVAEAIAAAAVFWHGGAPRRS |
Ga0209431_111376461 | 3300025313 | Soil | MRHFRLWLLTIGALSLAAEAIAAAAVFWRGAASIRRPGRLG |
Ga0209341_102650443 | 3300025325 | Soil | MRHFRLWLLLIAIVSLAAEAIAAAAVFWRGSLRARRPGRL |
Ga0209342_112278771 | 3300025326 | Soil | MRHFRLWLLVIGVVSLVAEAIAAAAVFWRGNPSARRPDGL |
Ga0210132_10178282 | 3300025538 | Natural And Restored Wetlands | MRHFRLWLVLIGALSLAAEAAAAMAVFWRGSIRRSSP |
Ga0210131_10035912 | 3300025551 | Natural And Restored Wetlands | MRHFRLWLLLIGALSLAAEAAAAMAVFWRGSIRRSSP |
Ga0210076_10098891 | 3300025567 | Natural And Restored Wetlands | MRHVRLWLLAIALVSVAAEAAAAAAVFWRGGPPERGV |
Ga0207688_110064842 | 3300025901 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHFRQWLLVIGLASLVAEAIAAAAVFWHGGYPARRSG |
Ga0207645_100849811 | 3300025907 | Miscanthus Rhizosphere | MRHFRQWLLVIGLASLVAEAIAAAAVFWHGGAPRRS |
Ga0207643_100090943 | 3300025908 | Miscanthus Rhizosphere | MRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS |
Ga0207643_107404183 | 3300025908 | Miscanthus Rhizosphere | RMRHFRLWLLVIGLVSLVAEAIAAAAVFWHGGAPRRS |
Ga0207684_113976631 | 3300025910 | Corn, Switchgrass And Miscanthus Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGGSPARRAG |
Ga0207644_117342222 | 3300025931 | Switchgrass Rhizosphere | MRHFRQWLLVIALASLVAEAIAAAAVFWHGQGSARRAG |
Ga0208654_10098212 | 3300026062 | Natural And Restored Wetlands | MRHFRTWLLLIGLVSLVAEAAAAAAVFWHGGTPLRRSQS |
Ga0209797_102902272 | 3300027831 | Wetland Sediment | HMRHVRLWLLTIGLLSLAAEAAAAAAVFWRGSAQRGSS |
Ga0209798_103404582 | 3300027843 | Wetland Sediment | MRHVRLWLLTIGLLSLAAEAAAAAAVFWRGSAQRGSS |
Ga0209481_104933402 | 3300027880 | Populus Rhizosphere | MRHFRTWLLVIGLASLVAEAAAAAAVFWRGGAPARRS |
Ga0209486_101513122 | 3300027886 | Agricultural Soil | MRHFRTWLLVIGLASLLAEAAAAAAVFWRAGTPLRRP |
Ga0209254_102428053 | 3300027897 | Freshwater Lake Sediment | MRHIRLWLLTIGLLSLVAEAAAAAAVFWRGSAQRGPS |
Ga0207428_103455823 | 3300027907 | Populus Rhizosphere | MRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS |
Ga0307316_101602393 | 3300028755 | Soil | MQHFKNWLLVIGLASLVAEAIAAAAVFWRGATQTSRP |
Ga0307503_102061683 | 3300028802 | Soil | GDMRHFRQWMLVIGLASLVAEAIAAAAVFWHGGTPARRS |
Ga0307296_105402381 | 3300028819 | Soil | MRHFRTWLLVIGLASLVAEAIAAAAVFWRGATQTSRP |
Ga0307312_102594842 | 3300028828 | Soil | MRHFKTWLLVIGLASLAAEAIAAVAVFWRGRTPAHRS |
Ga0307286_102039951 | 3300028876 | Soil | DEVRMRHFKNWLLVIGLASLVAEAIAAAAVFWRGATQTSRP |
Ga0307278_100320064 | 3300028878 | Soil | MRHFKNWLLVIALASLVAEAIAAAAVFWRGATQTSRP |
Ga0247826_106215772 | 3300030336 | Soil | MRHFRLWLLVIGLVSLIAEAIAAAAVFWHGGAPRRS |
Ga0247826_117749642 | 3300030336 | Soil | AQVDHWRMRHFRLWLLVIGLASLVAEAIAAAAVFWHGGAPRRS |
Ga0302046_104296753 | 3300030620 | Soil | MRHFRLWLLVIGVLSLAAEAVAAAAVFWRGSLPHRRPL |
Ga0299913_106294852 | 3300031229 | Soil | MRHFRLWLLAIGALSVVAEAIAAAAVFWRGGLPAARRFRAPS |
Ga0247829_106591562 | 3300033550 | Soil | MRHFRTWLLVIGVVSLVAEVAAAAAVFWHGGTPLRRS |
⦗Top⦘ |