 |
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |
| Basic Information | |
|---|---|
| Family ID | F105656 |
| Family Type | Metagenome |
| Number of Sequences | 100 |
| Average Sequence Length | 46 residues |
| Representative Sequence | MSIVSRRTFTKGLLASALVPGHSAIGQPNDPASIAIIDTPNNAA |
| Number of Associated Samples | 96 |
| Number of Associated Scaffolds | 100 |
| Quality Assessment | |
|---|---|
| Transcriptomic Evidence | No |
| Most common taxonomic group | Unclassified |
| % of genes with valid RBS motifs | 85.00 % |
| % of genes near scaffold ends (potentially truncated) | 98.00 % |
| % of genes from short scaffolds (< 2000 bps) | 90.00 % |
| Associated GOLD sequencing projects | 93 |
| AlphaFold2 3D model prediction | Yes |
| 3D model pTM-score | 0.19 |
| Hidden Markov Model |
|---|
| Powered by Skylign |
| Most Common Taxonomy | |
|---|---|
| Group | Unclassified (54.000 % of family members) |
| NCBI Taxonomy ID | N/A |
| Taxonomy | N/A |
| Most Common Ecosystem | |
|---|---|
| GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil (10.000 % of family members) |
| Environment Ontology (ENVO) | Unclassified (24.000 % of family members) |
| Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (39.000 % of family members) |
| ⦗Top⦘ |
| ⦗Top⦘ |
| Predicted Topology & Secondary Structure | |||||
|---|---|---|---|---|---|
| Classification: | Fibrous | Signal Peptide: | Yes | Secondary Structure distribution: | α-helix: 15.28% β-sheet: 0.00% Coil/Unstructured: 84.72% | Feature Viewer |
|
|
|||||
| Powered by Feature Viewer | |||||
| Structure Viewer | |
|---|---|
|
| |
| Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.19 |
| Powered by PDBe Molstar | |
| ⦗Top⦘ |
| Pfam ID | Name | % Frequency in 100 Family Scaffolds |
|---|---|---|
| PF01520 | Amidase_3 | 2.00 |
| PF03734 | YkuD | 2.00 |
| PF04226 | Transgly_assoc | 1.00 |
| PF00043 | GST_C | 1.00 |
| PF04773 | FecR | 1.00 |
| PF10009 | DUF2252 | 1.00 |
| PF00211 | Guanylate_cyc | 1.00 |
| PF00378 | ECH_1 | 1.00 |
| PF09955 | DUF2189 | 1.00 |
| COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
|---|---|---|---|
| COG0860 | N-acetylmuramoyl-L-alanine amidase | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG1376 | Lipoprotein-anchoring transpeptidase ErfK/SrfK | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG3034 | Murein L,D-transpeptidase YafK | Cell wall/membrane/envelope biogenesis [M] | 2.00 |
| COG0435 | Glutathionyl-hydroquinone reductase | Energy production and conversion [C] | 1.00 |
| COG0625 | Glutathione S-transferase | Posttranslational modification, protein turnover, chaperones [O] | 1.00 |
| COG2114 | Adenylate cyclase, class 3 | Signal transduction mechanisms [T] | 1.00 |
| COG2261 | Uncharacterized membrane protein YeaQ/YmgE, transglycosylase-associated protein family | General function prediction only [R] | 1.00 |
| ⦗Top⦘ |
| Name | Rank | Taxonomy | Distribution |
| Unclassified | root | N/A | 54.00 % |
| All Organisms | root | All Organisms | 46.00 % |
| Visualization |
|---|
| Powered by ApexCharts |
| ⦗Top⦘ |
| Habitat | Taxonomy | Distribution |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 10.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 9.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 6.00% |
| Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 6.00% |
| Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 5.00% |
| Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 5.00% |
| Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 5.00% |
| Rhizosphere Soil | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil | 4.00% |
| Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 3.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 3.00% |
| Corn Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere | 3.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 3.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 3.00% |
| Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 2.00% |
| Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 2.00% |
| Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.00% |
| Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 2.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 2.00% |
| Arabidopsis Thaliana Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere | 2.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.00% |
| Freshwater Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Freshwater Sediment | 1.00% |
| Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
| Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 1.00% |
| Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 1.00% |
| Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 1.00% |
| Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 1.00% |
| Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland | 1.00% |
| Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 1.00% |
| Prmafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Prmafrost Soil | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Arabidopsis Rhizosphere | Host-Associated → Plants → Roots → Rhizosphere → Unclassified → Arabidopsis Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 1.00% |
| Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 1.00% |
| Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 1.00% |
| Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 1.00% |
| Visualization |
|---|
| Powered by ApexCharts |
| Taxon OID | Sample Name | Habitat Type | IMG/M Link |
|---|---|---|---|
| 3300002549 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-212 | Environmental | Open in IMG/M |
| 3300004024 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqB_D2 | Environmental | Open in IMG/M |
| 3300005093 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All Blocks | Environmental | Open in IMG/M |
| 3300005169 | Soil and rhizosphere microbial communities from Laval, Canada - mgHPA | Environmental | Open in IMG/M |
| 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 | Host-Associated | Open in IMG/M |
| 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Environmental | Open in IMG/M |
| 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
| 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Environmental | Open in IMG/M |
| 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
| 3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
| 3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
| 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Host-Associated | Open in IMG/M |
| 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Host-Associated | Open in IMG/M |
| 3300006050 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2014 | Environmental | Open in IMG/M |
| 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
| 3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
| 3300006871 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Host-Associated | Open in IMG/M |
| 3300006903 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD5 | Host-Associated | Open in IMG/M |
| 3300006969 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 | Host-Associated | Open in IMG/M |
| 3300007821 | Permafrost core soil microbial communities from Svalbard, Norway - sample 2-10-2 Soapdenovo | Environmental | Open in IMG/M |
| 3300009029 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 1 DNA2013-189 | Environmental | Open in IMG/M |
| 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
| 3300009651 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-063 | Environmental | Open in IMG/M |
| 3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
| 3300010046 | Tropical forest soil microbial communities from Panama - MetaG Plot_36 | Environmental | Open in IMG/M |
| 3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
| 3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
| 3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
| 3300010366 | Tropical forest soil microbial communities from Panama - MetaG Plot_24 | Environmental | Open in IMG/M |
| 3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
| 3300010391 | Freshwater sediment microbial communities from Lake Superior, USA - Station SU-17. Combined Assembly of Gp0155404, Gp0155335, Gp0155336, Gp0155336, Gp0155403, Gp0155406 | Environmental | Open in IMG/M |
| 3300010399 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-3 | Environmental | Open in IMG/M |
| 3300011438 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT500_2 | Environmental | Open in IMG/M |
| 3300012476 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.yng.070610 | Host-Associated | Open in IMG/M |
| 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Host-Associated | Open in IMG/M |
| 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Host-Associated | Open in IMG/M |
| 3300012514 | Unplanted soil (control) microbial communities from North Carolina - M.Soil.1.old.130510 | Environmental | Open in IMG/M |
| 3300012901 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1 | Environmental | Open in IMG/M |
| 3300012948 | Tropical forest soil microbial communities from Panama - MetaG Plot_14 | Environmental | Open in IMG/M |
| 3300012951 | Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MG | Environmental | Open in IMG/M |
| 3300012987 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_243_MG | Environmental | Open in IMG/M |
| 3300012989 | Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MG | Environmental | Open in IMG/M |
| 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Host-Associated | Open in IMG/M |
| 3300013772 | Permafrost microbial communities from Nunavut, Canada - A10_80_0.25M | Environmental | Open in IMG/M |
| 3300014269 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D1 | Environmental | Open in IMG/M |
| 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Host-Associated | Open in IMG/M |
| 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Host-Associated | Open in IMG/M |
| 3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
| 3300017973 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MG | Environmental | Open in IMG/M |
| 3300017999 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_10_MG | Environmental | Open in IMG/M |
| 3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
| 3300020150 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP10_20_MG | Environmental | Open in IMG/M |
| 3300023062 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S081-202R-4 | Environmental | Open in IMG/M |
| 3300025549 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleA_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300025888 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Incubations 011-21A (SPAdes) | Environmental | Open in IMG/M |
| 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) | Environmental | Open in IMG/M |
| 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300025962 | Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Sandmound_ThreeSqB_D2 (SPAdes) | Environmental | Open in IMG/M |
| 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) | Host-Associated | Open in IMG/M |
| 3300026827 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G09A4-11 (SPAdes) | Environmental | Open in IMG/M |
| 3300027011 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 29 (SPAdes) | Environmental | Open in IMG/M |
| 3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
| 3300027024 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 42 (SPAdes) | Environmental | Open in IMG/M |
| 3300027039 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 14 (SPAdes) | Environmental | Open in IMG/M |
| 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) | Host-Associated | Open in IMG/M |
| 3300027437 | Soil microbial communities from Kellog Biological Station, Michigan, USA - Nitrogen cycling UWRJ-G05K2-12 (SPAdes) | Environmental | Open in IMG/M |
| 3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
| 3300028719 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182 | Environmental | Open in IMG/M |
| 3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
| 3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
| 3300031354 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-20 | Environmental | Open in IMG/M |
| 3300031360 | Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40 | Environmental | Open in IMG/M |
| 3300031562 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D3 | Environmental | Open in IMG/M |
| 3300031572 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19 | Environmental | Open in IMG/M |
| 3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
| 3300031724 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f20 | Environmental | Open in IMG/M |
| 3300031736 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21 | Environmental | Open in IMG/M |
| 3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
| 3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
| 3300031940 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D2 | Environmental | Open in IMG/M |
| 3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
| 3300031959 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f24 | Environmental | Open in IMG/M |
| 3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
| 3300033482 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D1_C | Environmental | Open in IMG/M |
| 3300033810 | Tropical peat soil microbial communities from peatlands in Loreto, Peru - SR_E | Environmental | Open in IMG/M |
| 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Host-Associated | Open in IMG/M |
| 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Host-Associated | Open in IMG/M |
| Geographical Distribution | |
|---|---|
| Zoom: | Powered by OpenStreetMap |
| ⦗Top⦘ |
| Protein ID | Sample Taxon ID | Habitat | Sequence |
| JGI24130J36418_100640521 | 3300002549 | Arctic Peat Soil | MSIVSRRTFTKGLLASALVPGHSAIGQPNDPGCIAIIDTPHNAAKV |
| Ga0055436_101586461 | 3300004024 | Natural And Restored Wetlands | MSIVSRRTFTKGLLASALVPGHSAIGQPNDPASIAIIDTPNNAA |
| Ga0062594_1003231771 | 3300005093 | Soil | MSLVSRRTFTSGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYASKLA |
| Ga0066810_100146362 | 3300005169 | Soil | MSIVSRRTFTKGLLASALVPGHSAIGQPNDAASIAIIDTPHNAAKVASKLAAQNVKVV |
| Ga0065704_104803461 | 3300005289 | Switchgrass Rhizosphere | MSVVSRRIFTKGLLASALVPSNLAVGQPNDPASIAIIDTPHNAAK |
| Ga0070683_1019817581 | 3300005329 | Corn Rhizosphere | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAK |
| Ga0070711_1013812581 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | MAIVSRRTFTHGLLASALVPGNLVIGQPNDPASIAIIDTPHNAAKVASKLAAQNV |
| Ga0070706_1011615171 | 3300005467 | Corn, Switchgrass And Miscanthus Rhizosphere | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDPASIAIIDTPNNAAKVASKLAAQNVKVVVR |
| Ga0068852_1020070641 | 3300005616 | Corn Rhizosphere | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYAAKLA |
| Ga0066905_1000941401 | 3300005713 | Tropical Forest Soil | MSVVSRRIFTQGLLASALMPSNLAVGQPNDPGSIAIIDTPHNAAKFASKLS |
| Ga0066903_1014436012 | 3300005764 | Tropical Forest Soil | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVI |
| Ga0068858_1018852592 | 3300005842 | Switchgrass Rhizosphere | MSIVSRRAFTQGLLASALVPGKLAIGQPNDPASIAIIDTP |
| Ga0068862_1022177312 | 3300005844 | Switchgrass Rhizosphere | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYASKLAAQNVKVVVR |
| Ga0075028_1000152667 | 3300006050 | Watersheds | MSILSRRTFTKGLLASALVPGHSAVGQPNDPGSIA |
| Ga0070712_1000370137 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIVSRRTFTHGLLASALVPGNLVIGQPNDPASIAIIDTPHNAAKVA |
| Ga0075425_1003133363 | 3300006854 | Populus Rhizosphere | MSTVSRRTFTTGLLASALVPGHSAFGHPNDAGCIAIVDTPQNAAKVASKLAAQNV |
| Ga0075425_1011988001 | 3300006854 | Populus Rhizosphere | MSIVSRRTFTRGLLASAWVPGHSAFGQPNDPAGIAIID |
| Ga0075434_1002833981 | 3300006871 | Populus Rhizosphere | MSVVSRRIFTKGLLASTLVPSTLAVGQPNDPGSIAIIDTPHNA |
| Ga0075426_106207851 | 3300006903 | Populus Rhizosphere | MSIISRRIFTKGLLASALVPGGSAIGQPNDPASIAI |
| Ga0075419_105813833 | 3300006969 | Populus Rhizosphere | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAIIDTPN |
| Ga0104323_1130482 | 3300007821 | Soil | MSIVSRRTFTKGLLASALVPGHSAIGQPNDPGSVAIIDTPHNAAKVASKLAAQ |
| Ga0066793_102122611 | 3300009029 | Prmafrost Soil | MSIVSRRTFTKGLLASALVPGRSAIGQPNDPGSIAIIDTPHN |
| Ga0105241_106113492 | 3300009174 | Corn Rhizosphere | MSIVSRRTFTKGLLASTLVPPGHSAIGQPNDPASIAIID |
| Ga0105859_12369621 | 3300009651 | Permafrost Soil | MLSRRTFTRGLLASALVPGNSAVGQSNDPAKIAIVD |
| Ga0126380_110120602 | 3300010043 | Tropical Forest Soil | MPTVSRRTFTNGVLASALVPGRAAFGQPNDPASIAIIDTPHNAA |
| Ga0126384_124216511 | 3300010046 | Tropical Forest Soil | MSVVSRRTFTKGLLASALVPGTAAVGQPNDPASIAIIDT |
| Ga0126382_104184122 | 3300010047 | Tropical Forest Soil | MSVVSRRIFTKGLLASALVPSNLAVGQPNDPGSIAII |
| Ga0126370_126645991 | 3300010358 | Tropical Forest Soil | MSVVSRRTFTKGLLASALVPGNSAIGQPNDLASIAIIDT |
| Ga0126376_119161242 | 3300010359 | Tropical Forest Soil | MSVVSRRTFTKGLLASALVPGTSAVGQPNDPASIAIIDTPHNAAKVASKLSA |
| Ga0126379_107878421 | 3300010366 | Tropical Forest Soil | MSIVSRRTFTTGLLASALVPGNSAVGQPNDLGSIAIID |
| Ga0126381_1022367471 | 3300010376 | Tropical Forest Soil | MSIVSRRTFTTGLLASALVPGNSAVGQPNDLGSIAIIDTPHNAAKVASKLSAQNVKV |
| Ga0126381_1024056492 | 3300010376 | Tropical Forest Soil | MSIVSRRTFTKGLLASALVPASSAVGQPNDLGSVAIIDTPHNAA |
| Ga0136847_135872612 | 3300010391 | Freshwater Sediment | MSIVSRRTFTGGLLASAFAPSHLVFGQSNDPGRIAIIDTPNNAA |
| Ga0134127_108388362 | 3300010399 | Terrestrial Soil | MSIISRRIFTKGLLASALVPGGSAIGQPNDPASIAIIDTPHNAAKVAS |
| Ga0137451_11986221 | 3300011438 | Soil | MSIISRRTFTKGLLASALVPGYSAIGQPNDPGSIAI |
| Ga0157344_10161042 | 3300012476 | Arabidopsis Rhizosphere | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAIIDTPNNAAKVA |
| Ga0157347_10075601 | 3300012502 | Arabidopsis Rhizosphere | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAIIDTPNNAAKVASKL |
| Ga0157316_10398002 | 3300012510 | Arabidopsis Rhizosphere | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAI |
| Ga0157330_10378692 | 3300012514 | Soil | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVFDAFLAALY |
| Ga0157288_100044273 | 3300012901 | Soil | MSIVSRRTFTKGLLASTLVPPGHSAIGQPNDPASIAI |
| Ga0126375_102335681 | 3300012948 | Tropical Forest Soil | MSVVSRRIFTQGLLASALMPSNLAVGQPNDPGSIAIIDTPHNAAKFASK |
| Ga0164300_1000020813 | 3300012951 | Soil | MSIVSRRTFTKGLLASALVPGTSAFGQPNDPASIAIID |
| Ga0164307_103475282 | 3300012987 | Soil | MMSIVSRRTFTKGLLASALVPGHAAIGQPNDPASIAIIDTPHNA |
| Ga0164305_113314871 | 3300012989 | Soil | MSIVSRRTFTKGLLASALVPGHSAFGQPNDPAGIAIIDTPNNAAKVAAKLSAQNV |
| Ga0157369_108909182 | 3300013105 | Corn Rhizosphere | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAIIDTPNNAAKVAS |
| Ga0120158_101865472 | 3300013772 | Permafrost | MSIVSRRTFTKGLLASALVPGHSAIGQPNDPGSIAIIDTPHNAAKVASKLATGRALF* |
| Ga0075302_10334332 | 3300014269 | Natural And Restored Wetlands | MSIVSRRTFTKGLLASALVPGHAAIGQPNDPAGIAIIDTPNNAAKVAANLSAQN |
| Ga0157380_107327622 | 3300014326 | Switchgrass Rhizosphere | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYASK |
| Ga0157377_100834801 | 3300014745 | Miscanthus Rhizosphere | MSLVSRRTFTSGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYAS |
| Ga0187779_111390332 | 3300017959 | Tropical Peatland | MSLVSRRTFTKGLLASTLVPGDLAFGQPNDAGSVAVIDTPH |
| Ga0187780_112200172 | 3300017973 | Tropical Peatland | MSIVSRRTFTGGLLAGAFAPSDWAVGQSNDPGKIAIV |
| Ga0187767_101161401 | 3300017999 | Tropical Peatland | MSIVSRRAFTGGLLAGAFAPSDLTFGQSNDPGKIAIVDTPNNAAKFA |
| Ga0187766_102631571 | 3300018058 | Tropical Peatland | MSVSRRTFTKGLLASALVPGLSAFGQPNDPAGIAIIDTPNNAAKLAD |
| Ga0187768_10536881 | 3300020150 | Tropical Peatland | MSIVSRRAFTGGLLAGAFAPSDLTFGQSNDPGKIAIVDTPNNAAKFAAK |
| Ga0247791_10433442 | 3300023062 | Soil | MSIVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAIIDTPNNAAK |
| Ga0210094_10398591 | 3300025549 | Natural And Restored Wetlands | MSIVSRRTFTKGLLASALVPGHAAIGQPNDPAGIAIIDTPNNAAKVAANLSAQNVK |
| Ga0209540_103996681 | 3300025888 | Arctic Peat Soil | MSIVSRRTFTKGLLASALVPGHSAIGQPNDPGSIAIIDT |
| Ga0207692_103955592 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIISRRTFTKGLLASALVPGMSAVGQPNDPASIAIIDT |
| Ga0207643_100949561 | 3300025908 | Miscanthus Rhizosphere | MSLLSRRTFTKGLLASALVPGNLAFGQPNDAGSVAVIDTPHNAAKYAAKLAAQ |
| Ga0207707_108259402 | 3300025912 | Corn Rhizosphere | MSILSRRTFTKGLLASALVPGTSAFGQPNDPASIAIIDTPHNAAKAASKLA |
| Ga0207693_101155201 | 3300025915 | Corn, Switchgrass And Miscanthus Rhizosphere | MSIVSRRTFTHGLLASALVPGNLVIGQPNDPASIAIIDTPHNAAKVASKLAAQN |
| Ga0207660_109596642 | 3300025917 | Corn Rhizosphere | MSIVSRRAFTQGLLASALVPGNLAIGQPNDPASIA |
| Ga0207649_100002941 | 3300025920 | Corn Rhizosphere | MSIVSRRTFTKGLLASALVPGTSAFGQPNDPASIAIIDTPQNAAK |
| Ga0207704_1000037626 | 3300025938 | Miscanthus Rhizosphere | MSIVSRRTFTKGLLASALVPGTSAFGQPNDPASIAIIDT |
| Ga0207689_116860562 | 3300025942 | Miscanthus Rhizosphere | MSIISRRIFTKGLLASALVPGGSAIGQPNDPASIAII |
| Ga0210070_10446361 | 3300025962 | Natural And Restored Wetlands | MSIVSRRTFTKGLLASTLVPGHSAIGQPNDPASIAIIDTPNNAARVASKL |
| Ga0207703_104427912 | 3300026035 | Switchgrass Rhizosphere | MSIVSRRTFTKGLLASALVPGTSAVGQPNDPASIAIIDT |
| Ga0207698_120135731 | 3300026142 | Corn Rhizosphere | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYA |
| Ga0207591_1099872 | 3300026827 | Soil | MSIVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAII |
| Ga0207740_10103151 | 3300027011 | Tropical Forest Soil | MSIVSRRTFTKGLLASALVPGNSAIGQPNDPGSIAIIDTPNNAAKVASKLSAQNVKVV |
| Ga0207815_10074162 | 3300027014 | Tropical Forest Soil | MSIVSRRTFTGGLLASALVPSSSVVGQPNDPGGIAIIDTPNNAAKVASKLSAQNV |
| Ga0207819_10123652 | 3300027024 | Tropical Forest Soil | MSIVSRRTFTKGLLASALVPGNSAIGQPNDPGSIAIIDTPNNAAKVASKLSAQN |
| Ga0207855_10631311 | 3300027039 | Tropical Forest Soil | MSIVSRRTFTKGLLASALVPGNSAIGQPNDPGSIAIIDT |
| Ga0209969_10462062 | 3300027360 | Arabidopsis Thaliana Rhizosphere | MSIVSRRTFTKGLLASALVPGASAFGQPNDPANIAIIDTPQNAAKVASKLAAQNVK |
| Ga0209996_10162802 | 3300027395 | Arabidopsis Thaliana Rhizosphere | MSIVSRRTFTKGLLASTLVPGHSAIGQPNDPASIAIIDTPIQK |
| Ga0207476_1021842 | 3300027437 | Soil | MSIVSRRTFTKGLLASALVPGTSAFGQPNDPASIAIIDTPQNAAKVAAKLAAQ |
| Ga0209583_105042021 | 3300027910 | Watersheds | MSILSRRTFTRGLLASALVPGHSAVGQSNDPASIAIIDTPHN |
| Ga0307301_102919022 | 3300028719 | Soil | MPVISRRTFTSGLLASALVPADLAVGQPNDAASIAIIDTPNNAAKVAAKLS |
| Ga0307323_101394722 | 3300028787 | Soil | MPVISRRTFTSGLLASALVPADLAVGQPNDAASIVIDTPNN |
| Ga0307497_100661961 | 3300031226 | Soil | MSIVSRRTFTKGLLASTLVPGHSAIGQPNDPASIAIIDTP |
| Ga0307497_100896402 | 3300031226 | Soil | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKY |
| Ga0307446_11065651 | 3300031354 | Salt Marsh | MPRVSRRAFTGGLLASAFVPANAAVGQPNDPGSIAIVDTPYNAAKVASKL |
| Ga0307444_11113321 | 3300031360 | Salt Marsh | MPHISRRAFTGGLLASAFVPANSAVGQPNDPGSIAIVDTPNNAAKVASKLSAQ |
| Ga0310886_100163353 | 3300031562 | Soil | MSLLSRRTFTKGLLASALVPGNLAFGQPNDAGSVAVIDTPHNAAKYAAKL |
| Ga0318515_101353224 | 3300031572 | Soil | MSLVSRRTFTKGLLTSTLVPGNLAFGQPNDAGSVAVIDTPHN |
| Ga0318542_101546432 | 3300031668 | Soil | MSLVSRRTFTKGLLTSTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYASKLATQN |
| Ga0318500_101380882 | 3300031724 | Soil | MSLVSRRTFTKGLLTSTLVPGNLAFGQPNDAGSVAVIDTPHNAAK |
| Ga0318501_102024512 | 3300031736 | Soil | MSLVSRRTFTKGLLTSTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYASKLAT |
| Ga0307473_110086171 | 3300031820 | Hardwood Forest Soil | MPIVSRRTFTKGLLASALVPGNAAVGQPNDPASIAII |
| Ga0306925_100014221 | 3300031890 | Soil | MSLVSRRTFTKGLLTSTLVPGNLAFGQPNDAGSVAVI |
| Ga0310901_105700722 | 3300031940 | Soil | MSIISRRIFTKGLLASALVPGGSAIGQPNDPASIAIIDTPHNAAKVASKLAAQ |
| Ga0310910_111731831 | 3300031946 | Soil | MPIISRRVFTGGLLASTLVPGDSVAGQSNDPASIAIIDTPNNA |
| Ga0318530_104315861 | 3300031959 | Soil | MSLVSRRTFTKGLLTSTLVPGNLAFGQPNDAGSVAVIDTPHNAA |
| Ga0307472_1023184151 | 3300032205 | Hardwood Forest Soil | MSIVSRRTFTKGLLASALVPGTSAFGQPNDPASIAIIDTPQNAAKVAAKLAA |
| Ga0316627_1025458681 | 3300033482 | Soil | MSIVSRRTFTKGLLASALLPGHSAMGQPNDPASIAIIDTPHNAAKAASKLAANNVKV |
| Ga0314872_026084_375_542 | 3300033810 | Peatland | MSIVSRRTFTTGLLASALVPGHAALGQPNDPAGIAIIDTPNNAAKVASKLADQNVK |
| Ga0373948_0004785_2029_2160 | 3300034817 | Rhizosphere Soil | MSIVSRRTFTKGLLASALVPGTSAFGQPNDPASIAIIDTPQNAA |
| Ga0373948_0037685_2_160 | 3300034817 | Rhizosphere Soil | MSLVSRRTFTKGLLASTLVPGNLAFGQPNDAGSVAVIDTPHNAAKYASKLAAQ |
| Ga0373958_0015428_1203_1349 | 3300034819 | Rhizosphere Soil | MSLVSRRTFTKGLLASTLVPGNFVFGQPNDAGSVAVIDTPHNAAKYASK |
| Ga0373959_0059319_732_842 | 3300034820 | Rhizosphere Soil | MSLVSRRTFTKGLLASTLVPGHSAIGQPNDLASIAII |
| ⦗Top⦘ |
|
Bioinformatics & Integrated Biology Lab Institute for Fundamental Biomedical Research Biomedical Sciences Research Center "Alexander Fleming" |