Basic Information | |
---|---|
Family ID | F105809 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 100 |
Average Sequence Length | 39 residues |
Representative Sequence | AQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA |
Number of Associated Samples | 90 |
Number of Associated Scaffolds | 100 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 0.00 % |
% of genes near scaffold ends (potentially truncated) | 100.00 % |
% of genes from short scaffolds (< 2000 bps) | 86.00 % |
Associated GOLD sequencing projects | 89 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.48 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (76.000 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (17.000 % of family members) |
Environment Ontology (ENVO) | Unclassified (18.000 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (51.000 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 10.61% β-sheet: 25.76% Coil/Unstructured: 63.64% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.48 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 100 Family Scaffolds |
---|---|---|
PF04149 | DUF397 | 45.00 |
PF13560 | HTH_31 | 8.00 |
PF00664 | ABC_membrane | 6.00 |
PF00821 | PEPCK_GTP | 5.00 |
PF12697 | Abhydrolase_6 | 4.00 |
PF03803 | Scramblase | 1.00 |
PF08044 | DUF1707 | 1.00 |
PF13668 | Ferritin_2 | 1.00 |
PF00483 | NTP_transferase | 1.00 |
PF00293 | NUDIX | 1.00 |
PF04672 | Methyltransf_19 | 1.00 |
PF13462 | Thioredoxin_4 | 1.00 |
PF00406 | ADK | 1.00 |
PF12680 | SnoaL_2 | 1.00 |
PF13483 | Lactamase_B_3 | 1.00 |
COG ID | Name | Functional Category | % Frequency in 100 Family Scaffolds |
---|---|---|---|
COG1274 | Phosphoenolpyruvate carboxykinase, GTP-dependent | Energy production and conversion [C] | 5.00 |
COG0563 | Adenylate kinase or related kinase | Nucleotide transport and metabolism [F] | 1.00 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 76.00 % |
Unclassified | root | N/A | 24.00 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300002245|JGIcombinedJ26739_101442435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 582 | Open in IMG/M |
3300005335|Ga0070666_10739324 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 723 | Open in IMG/M |
3300005542|Ga0070732_10676549 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura → Actinomadura madurae | 628 | Open in IMG/M |
3300005564|Ga0070664_100704713 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 941 | Open in IMG/M |
3300005616|Ga0068852_100430151 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1303 | Open in IMG/M |
3300005764|Ga0066903_101392992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1317 | Open in IMG/M |
3300005921|Ga0070766_10512564 | Not Available | 798 | Open in IMG/M |
3300005921|Ga0070766_11181905 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 529 | Open in IMG/M |
3300005995|Ga0066790_10008992 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4411 | Open in IMG/M |
3300006046|Ga0066652_100705052 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 961 | Open in IMG/M |
3300006162|Ga0075030_100575907 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 893 | Open in IMG/M |
3300006172|Ga0075018_10410121 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 691 | Open in IMG/M |
3300006175|Ga0070712_100268612 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1369 | Open in IMG/M |
3300006354|Ga0075021_10674676 | Not Available | 663 | Open in IMG/M |
3300006579|Ga0074054_12099031 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales | 1347 | Open in IMG/M |
3300006755|Ga0079222_10501042 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 889 | Open in IMG/M |
3300006804|Ga0079221_11656435 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Prauserella → Prauserella rugosa | 520 | Open in IMG/M |
3300006806|Ga0079220_10695946 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 746 | Open in IMG/M |
3300006806|Ga0079220_11200272 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae | 626 | Open in IMG/M |
3300006854|Ga0075425_100915062 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1002 | Open in IMG/M |
3300006893|Ga0073928_11103990 | Not Available | 537 | Open in IMG/M |
3300006953|Ga0074063_10087849 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 2200 | Open in IMG/M |
3300009162|Ga0075423_10837540 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 974 | Open in IMG/M |
3300009524|Ga0116225_1533247 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 521 | Open in IMG/M |
3300009698|Ga0116216_10363368 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 880 | Open in IMG/M |
3300009698|Ga0116216_10667542 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 625 | Open in IMG/M |
3300009700|Ga0116217_10260991 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1122 | Open in IMG/M |
3300009700|Ga0116217_10363133 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae | 923 | Open in IMG/M |
3300010329|Ga0134111_10421212 | Not Available | 575 | Open in IMG/M |
3300010371|Ga0134125_11905128 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 646 | Open in IMG/M |
3300010373|Ga0134128_12256376 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 600 | Open in IMG/M |
3300010379|Ga0136449_101352785 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1105 | Open in IMG/M |
3300010379|Ga0136449_102862011 | Not Available | 679 | Open in IMG/M |
3300010396|Ga0134126_10993535 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 940 | Open in IMG/M |
3300010403|Ga0134123_10282643 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1462 | Open in IMG/M |
3300010867|Ga0126347_1286642 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 522 | Open in IMG/M |
3300010876|Ga0126361_10530021 | Not Available | 1102 | Open in IMG/M |
3300012211|Ga0137377_11768883 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 538 | Open in IMG/M |
3300012351|Ga0137386_10421467 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 961 | Open in IMG/M |
3300012485|Ga0157325_1017178 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 610 | Open in IMG/M |
3300012515|Ga0157338_1013371 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 871 | Open in IMG/M |
3300012929|Ga0137404_10610116 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 981 | Open in IMG/M |
3300012984|Ga0164309_10851100 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 739 | Open in IMG/M |
3300015372|Ga0132256_102114174 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 668 | Open in IMG/M |
3300017937|Ga0187809_10340603 | Not Available | 560 | Open in IMG/M |
3300017943|Ga0187819_10088551 | All Organisms → cellular organisms → Bacteria | 1848 | Open in IMG/M |
3300017955|Ga0187817_10859843 | Not Available | 580 | Open in IMG/M |
3300017970|Ga0187783_11371933 | Not Available | 509 | Open in IMG/M |
3300017970|Ga0187783_11378356 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 508 | Open in IMG/M |
3300017975|Ga0187782_10050243 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3036 | Open in IMG/M |
3300018058|Ga0187766_10554521 | Not Available | 780 | Open in IMG/M |
3300020070|Ga0206356_11631246 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1703 | Open in IMG/M |
3300021403|Ga0210397_10040741 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2941 | Open in IMG/M |
3300021404|Ga0210389_10407486 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1069 | Open in IMG/M |
3300021406|Ga0210386_10778589 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Treboniaceae → Trebonia → Trebonia kvetii | 823 | Open in IMG/M |
3300021560|Ga0126371_11340644 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 848 | Open in IMG/M |
3300025625|Ga0208219_1015911 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2300 | Open in IMG/M |
3300025916|Ga0207663_10237362 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1335 | Open in IMG/M |
3300025929|Ga0207664_10144442 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2016 | Open in IMG/M |
3300025929|Ga0207664_10504716 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 1083 | Open in IMG/M |
3300025932|Ga0207690_11533180 | Not Available | 557 | Open in IMG/M |
3300026023|Ga0207677_12040441 | Not Available | 533 | Open in IMG/M |
3300026118|Ga0207675_100086617 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2941 | Open in IMG/M |
3300027570|Ga0208043_1008316 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3533 | Open in IMG/M |
3300027641|Ga0208827_1017511 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2674 | Open in IMG/M |
3300027727|Ga0209328_10083314 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales | 978 | Open in IMG/M |
3300027729|Ga0209248_10112658 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 818 | Open in IMG/M |
3300027829|Ga0209773_10117854 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium | 1100 | Open in IMG/M |
3300028789|Ga0302232_10056793 | Not Available | 2062 | Open in IMG/M |
3300029910|Ga0311369_10686509 | Not Available | 842 | Open in IMG/M |
3300030056|Ga0302181_10468716 | Not Available | 534 | Open in IMG/M |
3300030490|Ga0302184_10025925 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3092 | Open in IMG/M |
3300030580|Ga0311355_11175057 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 679 | Open in IMG/M |
3300030617|Ga0311356_10742594 | Not Available | 936 | Open in IMG/M |
3300031236|Ga0302324_100156871 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 3718 | Open in IMG/M |
3300031236|Ga0302324_100862302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 1251 | Open in IMG/M |
3300031564|Ga0318573_10383712 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 755 | Open in IMG/M |
3300031640|Ga0318555_10445614 | Not Available | 702 | Open in IMG/M |
3300031640|Ga0318555_10711751 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 542 | Open in IMG/M |
3300031668|Ga0318542_10313868 | All Organisms → cellular organisms → Bacteria → Terrabacteria group | 803 | Open in IMG/M |
3300031744|Ga0306918_10798737 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 737 | Open in IMG/M |
3300031764|Ga0318535_10194419 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria buriramensis | 907 | Open in IMG/M |
3300031768|Ga0318509_10556239 | Not Available | 640 | Open in IMG/M |
3300031781|Ga0318547_10417056 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 825 | Open in IMG/M |
3300031782|Ga0318552_10185393 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 1051 | Open in IMG/M |
3300031793|Ga0318548_10615710 | Not Available | 528 | Open in IMG/M |
3300031805|Ga0318497_10079958 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Pseudonocardiales → Pseudonocardiaceae → Kutzneria → Kutzneria buriramensis | 1730 | Open in IMG/M |
3300031890|Ga0306925_12082712 | Not Available | 532 | Open in IMG/M |
3300031910|Ga0306923_12366302 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 528 | Open in IMG/M |
3300031945|Ga0310913_10231875 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Micromonosporales → Micromonosporaceae → Hamadaea → Hamadaea tsunoensis | 1295 | Open in IMG/M |
3300031945|Ga0310913_11174216 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 535 | Open in IMG/M |
3300031947|Ga0310909_10682096 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 855 | Open in IMG/M |
3300032008|Ga0318562_10242651 | Not Available | 1046 | Open in IMG/M |
3300032076|Ga0306924_11466113 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales | 725 | Open in IMG/M |
3300032160|Ga0311301_10423352 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria | 2023 | Open in IMG/M |
3300032770|Ga0335085_11282168 | Not Available | 774 | Open in IMG/M |
3300032783|Ga0335079_11472631 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 673 | Open in IMG/M |
3300032828|Ga0335080_11040803 | Not Available | 831 | Open in IMG/M |
3300032892|Ga0335081_10078789 | All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia | 4994 | Open in IMG/M |
3300032896|Ga0335075_10880515 | Not Available | 824 | Open in IMG/M |
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 17.00% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 10.00% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 8.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 5.00% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 4.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 4.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 4.00% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 4.00% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 3.00% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.00% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 3.00% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 2.00% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 2.00% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 2.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 2.00% |
Agricultural Soil | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil | 2.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere | 2.00% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 2.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 2.00% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 2.00% |
Iron-Sulfur Acid Spring | Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 1.00% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 1.00% |
Surface Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil | 1.00% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere | 1.00% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil | 1.00% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.00% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 1.00% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 1.00% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 1.00% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 1.00% |
Arabidopsis Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere | 1.00% |
Visualization |
---|
Powered by ApexCharts |
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300002245 | Jack Pine, Ontario site 1_JW_OM2H0_M3 (Jack Pine, Ontario combined, ASSEMBLY_DATE=20131027) | Environmental | Open in IMG/M |
3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Host-Associated | Open in IMG/M |
3300005542 | Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 | Environmental | Open in IMG/M |
3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Host-Associated | Open in IMG/M |
3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005921 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 6 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006046 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_101 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006172 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2014 | Environmental | Open in IMG/M |
3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006579 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLAB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006804 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 | Environmental | Open in IMG/M |
3300006806 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS100 | Environmental | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006893 | Iron sulfur acid spring bacterial and archeal communities from Banff, Canada, to study Microbial Dark Matter (Phase II) - Paint Pots PPA 5.5 metaG | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300009162 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD2 | Host-Associated | Open in IMG/M |
3300009524 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_c_BC metaG | Environmental | Open in IMG/M |
3300009698 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_3_AS metaG | Environmental | Open in IMG/M |
3300009700 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG | Environmental | Open in IMG/M |
3300010329 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015 | Environmental | Open in IMG/M |
3300010371 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1 | Environmental | Open in IMG/M |
3300010373 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010396 | Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-2 | Environmental | Open in IMG/M |
3300010403 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3 | Environmental | Open in IMG/M |
3300010867 | Boreal forest soil eukaryotic communities from Alaska, USA - C3-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010876 | Boreal forest soil eukaryotic communities from Alaska, USA - W5-5 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300012211 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaG | Environmental | Open in IMG/M |
3300012351 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_100_16 metaG | Environmental | Open in IMG/M |
3300012485 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.7.old.040610 | Host-Associated | Open in IMG/M |
3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Host-Associated | Open in IMG/M |
3300012929 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300015372 | Soil combined assembly | Host-Associated | Open in IMG/M |
3300017937 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_4 | Environmental | Open in IMG/M |
3300017943 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_4 | Environmental | Open in IMG/M |
3300017955 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - SO4_2 | Environmental | Open in IMG/M |
3300017970 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP02_20_MG | Environmental | Open in IMG/M |
3300017975 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0715_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300021403 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-O | Environmental | Open in IMG/M |
3300021404 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-28-O | Environmental | Open in IMG/M |
3300021406 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-32-O | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300025625 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 53-2 shallow-072012 (SPAdes) | Environmental | Open in IMG/M |
3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027641 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_8_FC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027727 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM3H0_M1 (SPAdes) | Environmental | Open in IMG/M |
3300027729 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300027829 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM1 (SPAdes) | Environmental | Open in IMG/M |
3300028789 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3 | Environmental | Open in IMG/M |
3300029910 | III_Palsa_E2 coassembly | Environmental | Open in IMG/M |
3300030056 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_3 | Environmental | Open in IMG/M |
3300030490 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_N3_3 | Environmental | Open in IMG/M |
3300030580 | II_Palsa_N1 coassembly | Environmental | Open in IMG/M |
3300030617 | II_Palsa_N2 coassembly | Environmental | Open in IMG/M |
3300031236 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_1 | Environmental | Open in IMG/M |
3300031564 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21 | Environmental | Open in IMG/M |
3300031640 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f23 | Environmental | Open in IMG/M |
3300031668 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f23 | Environmental | Open in IMG/M |
3300031744 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2) | Environmental | Open in IMG/M |
3300031764 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f27 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031781 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f20 | Environmental | Open in IMG/M |
3300031782 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20 | Environmental | Open in IMG/M |
3300031793 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f21 | Environmental | Open in IMG/M |
3300031805 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23 | Environmental | Open in IMG/M |
3300031890 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2) | Environmental | Open in IMG/M |
3300031910 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.108 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031947 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.T000H | Environmental | Open in IMG/M |
3300032008 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f18 | Environmental | Open in IMG/M |
3300032076 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 (v2) | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032783 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.3 | Environmental | Open in IMG/M |
3300032828 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.4 | Environmental | Open in IMG/M |
3300032892 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.5 | Environmental | Open in IMG/M |
3300032896 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_2.4 | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Protein ID | Sample Taxon ID | Habitat | Sequence |
JGIcombinedJ26739_1014424352 | 3300002245 | Forest Soil | SGKFGAQLKRLSSAGFGSFVLVQVENGAVVRGELRALGSEE* |
Ga0070666_107393242 | 3300005335 | Switchgrass Rhizosphere | KFGAQLKRLEAAGCTGFVLVRSEDGTIVRGELRALGGDQGA* |
Ga0070732_106765491 | 3300005542 | Surface Soil | QLKRLETAGFGGFVSVRLENGVVVRGEVRELGGVLGC* |
Ga0070664_1007047131 | 3300005564 | Corn Rhizosphere | KFGAQLKRLEAAGFTGFVVLRTEDGAVVRGELRALGS* |
Ga0068852_1004301513 | 3300005616 | Corn Rhizosphere | QLKRLEAAGCTGFVLVRSEDGAIVRGELRTLGGDQGA* |
Ga0066903_1013929923 | 3300005764 | Tropical Forest Soil | KRLEAAGFTGFVLVRSEDGGIVRGEPRTLGGEPGA* |
Ga0070766_105125641 | 3300005921 | Soil | FGAQLKRLEAAGFGGFVVVRAEDGVIVTGELRALGGEPEG* |
Ga0070766_111819052 | 3300005921 | Soil | RLEAAGFSGFVLVRSEDGVTVAGELRELGGTPEA* |
Ga0066790_100089921 | 3300005995 | Soil | KFGAQLKRLEAAGFGGFVVVRVEDSMVVRGELRALGGEPGA* |
Ga0066652_1007050523 | 3300006046 | Soil | KRLEAAGFTGFVLVRSEDGAIVRGEERALGGEQGA* |
Ga0075030_1005759071 | 3300006162 | Watersheds | RRSGKFGAQLKRLETAGFSGFVLVRSENGVIVRGELRALGGQPEG* |
Ga0075018_104101212 | 3300006172 | Watersheds | LRRLEAAGFTGFVLVRSEDGAIVRGEERALGGEREA* |
Ga0070712_1002686123 | 3300006175 | Corn, Switchgrass And Miscanthus Rhizosphere | KFGAQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0075021_106746761 | 3300006354 | Watersheds | QLKRLEAAGFSGFVLVRSEDGVIVRGELRALGGQPEG* |
Ga0074054_120990311 | 3300006579 | Soil | LKRLEAAGFTGFVLVTSESESGAIVRGELRALGGGQGG* |
Ga0079222_105010421 | 3300006755 | Agricultural Soil | AQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0079221_116564351 | 3300006804 | Agricultural Soil | GKFGAQLKRLEAAGFTGFVVLRTEDGAAVRGELRGLGGQPGA* |
Ga0079220_106959462 | 3300006806 | Agricultural Soil | RKRLEAAGFTGFVLVRSEDGAIVRGEERMLGGERGA* |
Ga0079220_112002722 | 3300006806 | Agricultural Soil | RSGKFGAQLKRLEAAGCTGFVLVRSEDGVIVRGELRALGGDQGA* |
Ga0075425_1009150621 | 3300006854 | Populus Rhizosphere | RRSGKFGAQLKRLEAAGCTGFVLVRSEDGTIVRGELRALGGDQGA* |
Ga0073928_111039902 | 3300006893 | Iron-Sulfur Acid Spring | FGAQLKRLEAAGFGGFVLVRAENGTIVRGELRALGGGEPGA* |
Ga0074063_100878494 | 3300006953 | Soil | RLEAAGCTGFVLVRSEDGAIVRGELRALGGGQGG* |
Ga0075423_108375401 | 3300009162 | Populus Rhizosphere | KRLEAAGFTGFVLVRSEDGAIVRGEERALGGEPGA* |
Ga0116225_15332471 | 3300009524 | Peatlands Soil | RLEAAGFSGFVLVRSEDGVIVRGELRALGGQPEG* |
Ga0116216_103633681 | 3300009698 | Peatlands Soil | KRLEAAGFSGFVLVRSEDGVIVRGELRALGGQPEG* |
Ga0116216_106675422 | 3300009698 | Peatlands Soil | QLNRLEAAGFSGFVLVRSEDGVIVRGALRALGGEPGA* |
Ga0116217_102609913 | 3300009700 | Peatlands Soil | RRSGKFGAQLNRLEAAGFSGFVLVRSEDGVIVRGALRALGGEPGA* |
Ga0116217_103631331 | 3300009700 | Peatlands Soil | RRSGKFGAQLNRLEAAGFSGFVLVRSEDGVIVRGALRALGGDQST* |
Ga0134111_104212121 | 3300010329 | Grasslands Soil | LKRLEAAGFTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0134125_119051282 | 3300010371 | Terrestrial Soil | GKFGAQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0134128_122563762 | 3300010373 | Terrestrial Soil | GKCGAQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0136449_1013527852 | 3300010379 | Peatlands Soil | KFGAQLKRLEAAGFSGFVLVRSEDGVIVRGELRALGGQPGG* |
Ga0136449_1028620112 | 3300010379 | Peatlands Soil | KRLEAAGFSGFVLVRSEDGVIVRGELRALGGQPGG* |
Ga0134126_109935351 | 3300010396 | Terrestrial Soil | TVRRSGKFGAQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0134123_102826433 | 3300010403 | Terrestrial Soil | FGAQLKRLEAAGFTGFVLVRFESEAGAIVRGELRALGGDQGA* |
Ga0126347_12866421 | 3300010867 | Boreal Forest Soil | GKFGAQLKRLEAAGFSSFVHVQVEDDAVVRGELRALGGAGAL* |
Ga0126361_105300212 | 3300010876 | Boreal Forest Soil | FGAQLKRLEAAGFSGFVLVRSENGVIVRGELRALGGEPG* |
Ga0137377_117688831 | 3300012211 | Vadose Zone Soil | QLKRLEAAGFTGFVLVRLEDGAIVRGELRALGGTPRD* |
Ga0137386_104214673 | 3300012351 | Vadose Zone Soil | SGKFGAQLRRLEAAGFTGLVPLRIEDGALVRGELRALGS* |
Ga0157325_10171781 | 3300012485 | Arabidopsis Rhizosphere | GAAGFTGFVLVESRSESESEDGTIVRGELRALGGGQGG* |
Ga0157338_10133711 | 3300012515 | Arabidopsis Rhizosphere | AQLKRLEAAGCTGFVLVRSEDGVIVRGELRALGGGQGA* |
Ga0137404_106101161 | 3300012929 | Vadose Zone Soil | RLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA* |
Ga0164309_108511002 | 3300012984 | Soil | KFGAQLKRLEAAGFTGFVLVRSEDGAIVRGEERALGGERGA* |
Ga0132256_1021141742 | 3300015372 | Arabidopsis Rhizosphere | AQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGGQGA* |
Ga0187809_103406031 | 3300017937 | Freshwater Sediment | GKFGAQLKRLEAAGFTGFVLVSARDGAAGRGELRTLGGAADA |
Ga0187819_100885511 | 3300017943 | Freshwater Sediment | QLKRLETAGFTGFVLVTVADGAVVRGEQRTLGGSADA |
Ga0187817_108598432 | 3300017955 | Freshwater Sediment | KRLETAGFTGFVLVSVADGAVVRGELRTLGGGSPDA |
Ga0187783_113719331 | 3300017970 | Tropical Peatland | FGAQLKRLEGAGFTAFVLVRVEDGVTVRGTERELGSSAEA |
Ga0187783_113783562 | 3300017970 | Tropical Peatland | AAQLKRLEAAGFGGFVVVRLEDGAVVRGEERTLGSEPGA |
Ga0187782_100502431 | 3300017975 | Tropical Peatland | KFGAQLRRLETAGFGGFVLVSVQDGTVVRGELRTLGGGPPEA |
Ga0187766_105545212 | 3300018058 | Tropical Peatland | LKRLEAAGFGGFVLVSVENGATVRGEQRSLGGSPDA |
Ga0206356_116312463 | 3300020070 | Corn, Switchgrass And Miscanthus Rhizosphere | AQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA |
Ga0210397_100407411 | 3300021403 | Soil | RSGKFGAQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGGQGA |
Ga0210389_104074863 | 3300021404 | Soil | LRRLEATGFGGFVLIRSEDGVTVRGELRALGGERLD |
Ga0210386_107785891 | 3300021406 | Soil | GAQLKRLESAGFTAFVHVQSQEGQVVRGDLRPLGDE |
Ga0126371_113406441 | 3300021560 | Tropical Forest Soil | KRLATAGFTGFVLVRWEDGAITRSEPRDLGGEPGA |
Ga0208219_10159111 | 3300025625 | Arctic Peat Soil | GKFGAQLKRLKAAGFSGFVLLRAEDGVLVRGELRTLGGEPGA |
Ga0207663_102373623 | 3300025916 | Corn, Switchgrass And Miscanthus Rhizosphere | KRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA |
Ga0207664_101444421 | 3300025929 | Agricultural Soil | SGKFGAQLKRLEAAGFTGFMLLRVEDGAVVRGELRALGS |
Ga0207664_105047163 | 3300025929 | Agricultural Soil | LKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA |
Ga0207690_115331802 | 3300025932 | Corn Rhizosphere | FGAQLKRLEAAGCTGFVLVRSEDGAIVRGELRALGGDQGA |
Ga0207677_120404411 | 3300026023 | Miscanthus Rhizosphere | LKRLEAAGCTGFVLVRSEDGAIVRGELRTLGGDQGA |
Ga0207675_1000866176 | 3300026118 | Switchgrass Rhizosphere | LKRLEAAGCTGFVLVRSEDGAIVRSELRALGGDQGA |
Ga0208043_10083165 | 3300027570 | Peatlands Soil | GAQLKRLEAAGFSGFVLVRAEDGVIVRGELRALGGQPEG |
Ga0208827_10175114 | 3300027641 | Peatlands Soil | AQLKRLEAAGFSGFVLVRAEDGVIVRGELRALGGQPEG |
Ga0209328_100833143 | 3300027727 | Forest Soil | KRLEAAGFSGFVLVRSDNGVTVCGELRALGGEAGA |
Ga0209248_101126581 | 3300027729 | Bog Forest Soil | FGAQLKRLEAAGFGGFVSVRLEDGAVVRGELRALGEF |
Ga0209773_101178542 | 3300027829 | Bog Forest Soil | FGAQLKRLEAAGFSSFVLVQLEDGAVVRGELRALGGAG |
Ga0302232_100567931 | 3300028789 | Palsa | RSGKFGAQLKRLEAAGFEGFVLVRAEDGVIVTGEVRALGGESSG |
Ga0311369_106865091 | 3300029910 | Palsa | QLKRLEAAGFGGFVVVRAEDGVIVTGELRALGGEPEG |
Ga0302181_104687161 | 3300030056 | Palsa | KRLEAAGFGGFVVVRAEDGVIVTGELRALGGEPEG |
Ga0302184_100259255 | 3300030490 | Palsa | KFGAQLKRLETAGFSGFVLVRAEDGAVVRGELRTLGGEPGA |
Ga0311355_111750571 | 3300030580 | Palsa | QLKRLEAAGFDGFVVVRAEDGVIATGELRALGGEPGA |
Ga0311356_107425941 | 3300030617 | Palsa | AQLKRLEAAGFDGFAVVRAEDGVVVTGEVRALGGASPT |
Ga0302324_1001568711 | 3300031236 | Palsa | QLKRLETAGFSGFVLVRASDGAVVRGELRTLGGEPGA |
Ga0302324_1008623021 | 3300031236 | Palsa | KFGAQLKRLEAAGFVGFVVVRAEDGVIVTGELRALG |
Ga0318573_103837122 | 3300031564 | Soil | GKFGVQLKRLAAAGFTGFVLVRWEDGAISRSEPRDLGGEPGA |
Ga0318555_104456142 | 3300031640 | Soil | AQLTRLEAAGFSGFVLVSMQDGAVVRGDLRELGGSAEA |
Ga0318555_107117511 | 3300031640 | Soil | LKRLAAAGFTGFVLVRWEDGAIARSEPRDLGGEPGA |
Ga0318542_103138682 | 3300031668 | Soil | FGAQLTRLEAAGFSGFVLVSMADGAVVRGELRALGGAAGA |
Ga0306918_107987372 | 3300031744 | Soil | SGKFGAQLKRLAAAGFTGFVLVRWEDGAIARSEPRDLGGEPGA |
Ga0318535_101944191 | 3300031764 | Soil | QLTRLEAAGFSGFVLVSMADGAVVRGELRALGGAAGA |
Ga0318509_105562391 | 3300031768 | Soil | GAQLKRLETAGFTGFVLVQSVDGAIVRSEQRSLGD |
Ga0318547_104170563 | 3300031781 | Soil | FGAQLKRLEAAGFTGFVLVRSEDGTIVRGEPRALGGGA |
Ga0318552_101853933 | 3300031782 | Soil | QLKRLAAAGFTGFVLVRWEDGAIARSEARDLGGEPGA |
Ga0318548_106157101 | 3300031793 | Soil | FAAQLKRLEAAGFTGFVLVRMEDGAVVRGELRALGGAAQG |
Ga0318497_100799582 | 3300031805 | Soil | FGAQLTRLEAAGFSGFVLVNMADGAVVRGELRALGGAAGA |
Ga0306925_120827122 | 3300031890 | Soil | AQLKRLEAAGFTGFVLVRMEDGAVVRGELRALGGAAQG |
Ga0306923_123663021 | 3300031910 | Soil | QLKRLAAAGFTGFVLVRWEDGAIARSEPRDLGGEPGA |
Ga0310913_102318751 | 3300031945 | Soil | RSGKFGAQLTRLEAAGFSGFVLVSMADGAVVRGELRALGGAAGG |
Ga0310913_111742161 | 3300031945 | Soil | AAERKLGAQLKRLEAAGFTGFVLVRSEDGDIVRGEPRTLGGEPGA |
Ga0310909_106820962 | 3300031947 | Soil | GAQLTRLETAGFTGFVLVSVADGAVVRGELRALGGAAGA |
Ga0318562_102426511 | 3300032008 | Soil | RWSGKFGAQLTRLEAAGFSGFVLVSMQDGAVVRGDLRELGGSAEA |
Ga0306924_114661131 | 3300032076 | Soil | LKRLEAAGFSEFVPVRAENGVTVRGEPRALGGERGA |
Ga0311301_104233524 | 3300032160 | Peatlands Soil | VRRSGKFGAQLNRLEAAGFSGFVLVRSEDGVIVRGALRALGGEPGA |
Ga0335085_112821682 | 3300032770 | Soil | FGAQLKRLEAAGFTGFVVLRTEDGAVVRGELRGLGGPPGA |
Ga0335079_114726311 | 3300032783 | Soil | GAQLKRLEAAGFTRFVLVRSEDGAIVRGEPRALGGGQET |
Ga0335080_110408031 | 3300032828 | Soil | FGAQLKRLEAAGFTGFVLVRVVDGATVAGELRALGGAPGGGPVA |
Ga0335081_100787891 | 3300032892 | Soil | GAQLKRLEAAGFTGFVLVRSESGSESEGGAIVRGELRALGGNQGA |
Ga0335075_108805151 | 3300032896 | Soil | RRSGKFGAQLKRLEGAGFKAFVLVSAVEEVAVRGELRGLGDQA |
⦗Top⦘ |