NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F105990

Metagenome / Metatranscriptome Family F105990

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F105990
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 50 residues
Representative Sequence MNNDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG
Number of Associated Samples 78
Number of Associated Scaffolds 97

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 88.00 %
% of genes near scaffold ends (potentially truncated) 28.00 %
% of genes from short scaffolds (< 2000 bps) 86.00 %
Associated GOLD sequencing projects 70
AlphaFold2 3D model prediction Yes
3D model pTM-score0.16

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (51.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere
(19.000 % of family members)
Environment Ontology (ENVO) Unclassified
(27.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(48.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 12.82%    β-sheet: 0.00%    Coil/Unstructured: 87.18%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.16
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 97 Family Scaffolds
PF13517FG-GAP_3 3.09
PF05163DinB 2.06
PF00550PP-binding 1.03
PF01546Peptidase_M20 1.03
PF02604PhdYeFM_antitox 1.03
PF00582Usp 1.03
PF16313DUF4953 1.03
PF07238PilZ 1.03
PF03713DUF305 1.03
PF03795YCII 1.03
PF00266Aminotran_5 1.03
PF01797Y1_Tnp 1.03
PF07676PD40 1.03
PF12681Glyoxalase_2 1.03
PF12704MacB_PCD 1.03

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 97 Family Scaffolds
COG2318Bacillithiol/mycothiol S-transferase BstA/DinB, DinB/YfiT family (unrelated to E. coli DinB)Secondary metabolites biosynthesis, transport and catabolism [Q] 2.06
COG1943REP element-mobilizing transposase RayTMobilome: prophages, transposons [X] 1.03
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.03
COG2350YciI superfamily enzyme, includes 5-CHQ dehydrochlorinase, contains active-site pHisSecondary metabolites biosynthesis, transport and catabolism [Q] 1.03
COG3544Uncharacterized conserved protein, DUF305 familyFunction unknown [S] 1.03
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.03

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms51.00 %
UnclassifiedrootN/A49.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2189573004|GZGWRS402GN0XANot Available526Open in IMG/M
3300002568|C688J35102_120815384All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171669Open in IMG/M
3300003324|soilH2_10231567All Organisms → cellular organisms → Bacteria1356Open in IMG/M
3300003573|Ga0007412J51696_1065537Not Available576Open in IMG/M
3300004104|Ga0058891_1260091Not Available615Open in IMG/M
3300004114|Ga0062593_101381125Not Available751Open in IMG/M
3300004479|Ga0062595_100167855All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171307Open in IMG/M
3300004479|Ga0062595_101911450Not Available569Open in IMG/M
3300004799|Ga0058863_11573472Not Available566Open in IMG/M
3300004800|Ga0058861_10091250All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171368Open in IMG/M
3300004803|Ga0058862_12250748Not Available566Open in IMG/M
3300005329|Ga0070683_101124682Not Available754Open in IMG/M
3300005434|Ga0070709_10064506All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172342Open in IMG/M
3300005434|Ga0070709_10511584Not Available914Open in IMG/M
3300005434|Ga0070709_10680958All Organisms → cellular organisms → Bacteria → Proteobacteria799Open in IMG/M
3300005435|Ga0070714_100846909All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117887Open in IMG/M
3300005435|Ga0070714_101322318All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117704Open in IMG/M
3300005436|Ga0070713_102386685All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117511Open in IMG/M
3300005437|Ga0070710_10118356Not Available1600Open in IMG/M
3300005439|Ga0070711_100036524All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1173291Open in IMG/M
3300005439|Ga0070711_100724513Not Available839Open in IMG/M
3300005439|Ga0070711_100724513Not Available839Open in IMG/M
3300005458|Ga0070681_10110452All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia2689Open in IMG/M
3300005526|Ga0073909_10183708All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117894Open in IMG/M
3300005526|Ga0073909_10430900Not Available626Open in IMG/M
3300005529|Ga0070741_10003983All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Acidobacteriales → Acidobacteriaceae35300Open in IMG/M
3300005533|Ga0070734_10001618All Organisms → cellular organisms → Bacteria31581Open in IMG/M
3300005535|Ga0070684_100015509All Organisms → cellular organisms → Bacteria6208Open in IMG/M
3300005537|Ga0070730_10125145All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1760Open in IMG/M
3300005542|Ga0070732_10734067All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117601Open in IMG/M
3300005577|Ga0068857_100446343All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171209Open in IMG/M
3300006028|Ga0070717_10109979Not Available2350Open in IMG/M
3300006028|Ga0070717_11015070Not Available756Open in IMG/M
3300006028|Ga0070717_11878944All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117540Open in IMG/M
3300006163|Ga0070715_10327586All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117829Open in IMG/M
3300006163|Ga0070715_10338409Not Available818Open in IMG/M
3300006173|Ga0070716_101285745Not Available591Open in IMG/M
3300006175|Ga0070712_100428146Not Available1098Open in IMG/M
3300006800|Ga0066660_10903148Not Available719Open in IMG/M
3300006954|Ga0079219_10240080Not Available1067Open in IMG/M
3300009098|Ga0105245_11310051All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117773Open in IMG/M
3300009174|Ga0105241_11441037All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117661Open in IMG/M
3300010154|Ga0127503_10706785Not Available648Open in IMG/M
3300010358|Ga0126370_11128581Not Available724Open in IMG/M
3300010358|Ga0126370_11128581Not Available724Open in IMG/M
3300010366|Ga0126379_10946466All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117965Open in IMG/M
3300010371|Ga0134125_10123373All Organisms → cellular organisms → Bacteria2884Open in IMG/M
3300010371|Ga0134125_10243388All Organisms → cellular organisms → Bacteria1999Open in IMG/M
3300010371|Ga0134125_11041033Not Available897Open in IMG/M
3300010373|Ga0134128_10115451All Organisms → cellular organisms → Bacteria3047Open in IMG/M
3300010375|Ga0105239_10028416All Organisms → cellular organisms → Bacteria → Acidobacteria6151Open in IMG/M
3300010376|Ga0126381_101217917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171088Open in IMG/M
3300010376|Ga0126381_101217917All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171088Open in IMG/M
3300011120|Ga0150983_10703639Not Available551Open in IMG/M
3300012212|Ga0150985_106670091Not Available954Open in IMG/M
3300012944|Ga0137410_10871477Not Available760Open in IMG/M
3300012960|Ga0164301_10248807All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171166Open in IMG/M
3300012984|Ga0164309_11904379All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117510Open in IMG/M
3300012985|Ga0164308_10032994Not Available3183Open in IMG/M
3300012988|Ga0164306_12015343Not Available502Open in IMG/M
3300013100|Ga0157373_11414796All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117529Open in IMG/M
3300016270|Ga0182036_10618355All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117870Open in IMG/M
3300020069|Ga0197907_11211113Not Available541Open in IMG/M
3300020069|Ga0197907_11275469Not Available501Open in IMG/M
3300020070|Ga0206356_10367459All Organisms → cellular organisms → Bacteria1687Open in IMG/M
3300020070|Ga0206356_10386849Not Available552Open in IMG/M
3300020075|Ga0206349_1062655Not Available537Open in IMG/M
3300020081|Ga0206354_11669594Not Available600Open in IMG/M
3300020610|Ga0154015_1164324Not Available696Open in IMG/M
3300021560|Ga0126371_10262956Not Available1843Open in IMG/M
3300021560|Ga0126371_11666379Not Available762Open in IMG/M
3300021560|Ga0126371_12193612All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117666Open in IMG/M
3300021560|Ga0126371_12367887Not Available642Open in IMG/M
3300022467|Ga0224712_10519163Not Available577Open in IMG/M
3300022467|Ga0224712_10668764Not Available510Open in IMG/M
3300022530|Ga0242658_1151378Not Available599Open in IMG/M
3300022531|Ga0242660_1117373Not Available668Open in IMG/M
3300025898|Ga0207692_10040661All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172296Open in IMG/M
3300025905|Ga0207685_10116893All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171165Open in IMG/M
3300025905|Ga0207685_10581105Not Available599Open in IMG/M
3300025913|Ga0207695_10317088All Organisms → cellular organisms → Bacteria1449Open in IMG/M
3300025915|Ga0207693_10794105All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117730Open in IMG/M
3300025917|Ga0207660_10117599All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1172009Open in IMG/M
3300025927|Ga0207687_11111745All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117679Open in IMG/M
3300026078|Ga0207702_12017806All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117567Open in IMG/M
3300027775|Ga0209177_10512909Not Available502Open in IMG/M
3300027821|Ga0209811_10055209All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171365Open in IMG/M
3300027842|Ga0209580_10019389All Organisms → cellular organisms → Bacteria → Acidobacteria3011Open in IMG/M
3300027842|Ga0209580_10577671All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117558Open in IMG/M
3300027857|Ga0209166_10097416All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium1645Open in IMG/M
3300030916|Ga0075386_12165683Not Available533Open in IMG/M
3300030945|Ga0075373_11644471Not Available646Open in IMG/M
3300030946|Ga0075379_10837989Not Available587Open in IMG/M
3300031057|Ga0170834_106898173Not Available647Open in IMG/M
3300031231|Ga0170824_115368761Not Available666Open in IMG/M
3300031938|Ga0308175_100243005All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171802Open in IMG/M
3300031996|Ga0308176_11514867All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117714Open in IMG/M
3300032261|Ga0306920_102545109All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117703Open in IMG/M
3300033412|Ga0310810_11121110All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA117651Open in IMG/M
3300033475|Ga0310811_10448257All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Angelobacter → unclassified Candidatus Angelobacter → Candidatus Angelobacter sp. Gp1-AA1171382Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere19.00%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil10.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil9.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere9.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil4.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.00%
Host-AssociatedHost-Associated → Human → Digestive System → Large Intestine → Fecal → Host-Associated3.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere3.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil2.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil2.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Agricultural Soil2.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere2.00%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil1.00%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil1.00%
Sugarcane Root And Bulk SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Sugarcane Root And Bulk Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2189573004Grass soil microbial communities from Rothamsted Park, UK - FG2 (Nitrogen)EnvironmentalOpen in IMG/M
3300002568Grasslands soil microbial communities from Hopland, California, USA - 2EnvironmentalOpen in IMG/M
3300003324Sugarcane bulk soil Sample H2EnvironmentalOpen in IMG/M
3300003573Grassland soil microbial communities from Hopland, California, USA - Sample H1_Bulk_28 (Metagenome Metatranscriptome, Counting Only)Host-AssociatedOpen in IMG/M
3300004104Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF218 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004479Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of All WPAsEnvironmentalOpen in IMG/M
3300004799Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004800Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300004803Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300005329Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaGEnvironmentalOpen in IMG/M
3300005434Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaGEnvironmentalOpen in IMG/M
3300005435Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaGEnvironmentalOpen in IMG/M
3300005436Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaGEnvironmentalOpen in IMG/M
3300005437Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaGEnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005458Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaGEnvironmentalOpen in IMG/M
3300005526Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1EnvironmentalOpen in IMG/M
3300005529Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen16_06102014_R1EnvironmentalOpen in IMG/M
3300005533Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen06_05102014_R1EnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005537Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1EnvironmentalOpen in IMG/M
3300005542Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1EnvironmentalOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006173Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaGEnvironmentalOpen in IMG/M
3300006175Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaGEnvironmentalOpen in IMG/M
3300006800Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_109EnvironmentalOpen in IMG/M
3300006954Agricultural soil microbial communities from Georgia to study Nitrogen management - GA ControlEnvironmentalOpen in IMG/M
3300009098Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaGHost-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300010154Soil microbial communities from Willow Creek, Wisconsin, USA - WC-WI-TBF metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012960Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_231_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300012988Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_242_MGEnvironmentalOpen in IMG/M
3300013100Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaGHost-AssociatedOpen in IMG/M
3300016270Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080EnvironmentalOpen in IMG/M
3300020069Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020070Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020075Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020081Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300020610Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300022467Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022531Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-H-28-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025905Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025915Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025917Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026078Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027775Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Control (SPAdes)EnvironmentalOpen in IMG/M
3300027821Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire. - Coalmine Soil_Cen17_06102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027842Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen04_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300027857Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen01_05102014_R1 (SPAdes)EnvironmentalOpen in IMG/M
3300030916Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA12 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030945Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA10 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030946Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA7 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031057Oak Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031231Coassembly Site 11 (all samples) - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031938Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R1EnvironmentalOpen in IMG/M
3300031996Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.C.R2EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
FG2_019609102189573004Grass SoilMNNDKRVLGRQGARELAPSEADHVNGGIITRLSVCTIP
C688J35102_12081538433300002568SoilMNNDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTHGCDGDTTG*
soilH2_1023156713300003324Sugarcane Root And Bulk SoilMKNDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0007412J51696_106553723300003573Avena Fatua RhizosphereMNSDKRVLARQGAKELTPSEADHVIGGISTRLTVCTIPRPGTTGCDGDTTS*
Ga0058891_126009133300004104Forest SoilMNNDKRVLGRQGAKELTPNEADHVIGGIATRLTVCTIPRPGMQGCDGDTTS*
Ga0062593_10138112513300004114SoilMNNDKRVLGRQGAKELTPSEADHVNGGITTLLSVCTIPRPGTVGCDGDVTS*
Ga0062595_10016785523300004479SoilMNNDKRVLGRQGAKELTPSEADNVTGGISTLLSVCTIPRPGTVGCDGDVTT*
Ga0062595_10191145023300004479SoilMNDDKRVLARQGAKELTSSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0058863_1157347213300004799Host-AssociatedMNNDKRVLGRQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*SKAC
Ga0058861_1009125023300004800Host-AssociatedMNDDKRVLARRGARELTPSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG*
Ga0058862_1225074813300004803Host-AssociatedMNNDKRVLGRQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0070683_10112468213300005329Corn RhizosphereVNNDKRVLARQGAKELTPGEADHVVGGISTLTVCTIPRPGTVGCDGDTTG*
Ga0070709_1006450643300005434Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTLSEADHVNGGFSTLSVCTIPRPGTHGCDDTVTS*
Ga0070709_1051158413300005434Corn, Switchgrass And Miscanthus RhizosphereMNDDKRVLARQGAKELTSSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*SKACSGRSPHELSAQK
Ga0070709_1068095823300005434Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGAKELTPSEADHVNGGIITRLSVCTIPRPGTQGCDGDVTS*
Ga0070714_10084690923300005435Agricultural SoilMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG*
Ga0070714_10132231813300005435Agricultural SoilDKRVLARQGAKELTSSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0070713_10238668513300005436Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTSSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG*
Ga0070710_1011835613300005437Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGD
Ga0070711_10003652443300005439Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGARELAPSEADHVNGGIITRLSVCTIPRPGTTGCDADTTS*
Ga0070711_10072451323300005439Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARRGAKELTPSEADHVNGGIITLFTLCTIPRPGTVGCDGDTNP*
Ga0070711_10072451333300005439Corn, Switchgrass And Miscanthus RhizosphereMNDDKRVLARRGAKELTPSEAGHVNGGIITRLSVCTIPRPGTVGCDGDTTS*
Ga0070681_1011045213300005458Corn RhizosphereERKRHVNNDKRVLARQGAKELTPGEADHVVGGISTLTVCTIPRPGTVGCDGDTTG*
Ga0073909_1018370833300005526Surface SoilMDNAKRVLARLGAKELTPSEADHVNGGIITRLSVCTIPRPGTVGCDGDTTS*
Ga0073909_1043090013300005526Surface SoilMNNDKRVLGRRGAKELTPSETDHVNGGIATLLSVCTIPRPGTVGCDGDVTT*
Ga0070741_10003983333300005529Surface SoilMNNDKRVLGRLGAKELTPSETDHVIGGISTLLSVCTIPRPGTVGCDGDHTT*
Ga0070734_10001618133300005533Surface SoilMTKEQARQGAKGLTPSEADHVVGGLSTLTVCTIPSPGTSGCDGDTTG*
Ga0070684_10001550933300005535Corn RhizosphereMNDDKRVLARRGARELTSSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG*
Ga0070730_1012514523300005537Surface SoilMNNDKRVLGRQGAKELTPSEADHVNGGITTRLTVCTIPRPGTTGCDGDTTS*
Ga0070732_1073406723300005542Surface SoilMNNDKRVLARQGAKELTSSEADHVVGGFSTLTVCTIPRPGTTGCDGDTTG*
Ga0068857_10044634323300005577Corn RhizosphereMNDDKRVLARGGARELTPSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG*
Ga0070717_1010997943300006028Corn, Switchgrass And Miscanthus RhizosphereMNNDNRVLARQGAKELAPNEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG*
Ga0070717_1101507023300006028Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGARELAPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0070717_1187894423300006028Corn, Switchgrass And Miscanthus RhizosphereRQGAKELTSSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0070715_1032758623300006163Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTPSEADHVNGGIITRLSVCTIPRPGTVGCDGDVTS*
Ga0070715_1033840913300006163Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCD
Ga0070716_10128574523300006173Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGAKELTPGEADHVNGGIATLLSVCTIPRPGTVGCDGDVTT*
Ga0070712_10042814633300006175Corn, Switchgrass And Miscanthus RhizosphereMNNDQRVLGRQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0066660_1090314813300006800SoilMNSDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0079219_1024008043300006954Agricultural SoilMDNDKRVLARLGAKELTPSEADHVNGGIITRLSVCTIPRPGTQGCDGDMTS
Ga0105245_1131005123300009098Miscanthus RhizosphereNKKGEKHMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG*
Ga0105241_1144103713300009174Corn RhizosphereRKEKHMNDDKRVLARRGARELTPSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG*
Ga0127503_1070678513300010154SoilMSNDKRVLGRQGAKELTPSEADHVIGGIITRLSLCTIPRPGTQGCDGDVTS*
Ga0126370_1112858113300010358Tropical Forest SoilMNNDKRVLARQGAKELAPGEADHVVGGLSTLTVCTIPRPGTVGCDGDTNP*
Ga0126370_1112858123300010358Tropical Forest SoilMNDDKRVLARRGAKELTPSEADHVNGGIITRLSVCTIPRPGTVGCDGDTTS*
Ga0126379_1094646623300010366Tropical Forest SoilELTPSEADHVNGGITTRLSVCTIPRPGTQGCDGDVTS*
Ga0134125_1012337343300010371Terrestrial SoilMNTDKRVLGRQGARELAPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG*
Ga0134125_1024338843300010371Terrestrial SoilMNDDKRVLARQGAKELTPSEADHVVGGLSTLTVCTI
Ga0134125_1104103333300010371Terrestrial SoilMSDDKRVLARRGARELTPSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG*
Ga0134128_1011545133300010373Terrestrial SoilMNKDKRVLGRQGARELAPGEADHVNGGISTLSVCTIPRPGTQGCDGDSLT*
Ga0105239_1002841663300010375Corn RhizosphereMSDDKRVLARTGARELTPSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG*
Ga0126381_10121791713300010376Tropical Forest SoilMNNDKRVLARQGAKELTPSEADHVNGGIRTLFTLCTIPRPGMVGCDGDTNP*
Ga0126381_10121791723300010376Tropical Forest SoilMNNDKRVLARQGAKELAPGEADHVIGGLSTLTVCTIPRPGTHGCDGDTAG*
Ga0150983_1070363923300011120Forest SoilMNNDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTTGCDGDTTG*
Ga0150985_10667009123300012212Avena Fatua RhizosphereMNNDKRVLGRQGAKELSPSESDHVIGGVTTLISVCTIPRPGTHGCDGDVTS*
Ga0137410_1087147723300012944Vadose Zone SoilMNNDNRVLGRQGAKELTPSEADHVIGGISTLLSVCTIPRPG
Ga0164301_1024880723300012960SoilMNSDKRVLGRQGARELAPSEADHVNGGISTLSVCTIPRPGTQGCDGDVIG*
Ga0164309_1190437913300012984SoilAKELTPAEADHVNGGITTRLSVCTIPRPGTTGCDGDVTS*
Ga0164308_1003299413300012985SoilMNNDKRVLGRQGAKELTPSEADHVNGGIITRLSVCTIPRPGTV
Ga0164306_1201534313300012988SoilMNNDKRVLGRRGAKELTPSEADHVNGGITTRLTVCTIPRPGTTGCDGDTTS*
Ga0157373_1141479623300013100Corn RhizosphereNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG*
Ga0182036_1061835523300016270SoilMNSDKRVLARQGAKELTPSETDHVMGGVITLLTVCTIPQPGMQGCDGDKSF
Ga0197907_1121111313300020069Corn, Switchgrass And Miscanthus RhizosphereMNDDKRVLARQGAKELTSSEADHVVGGLSTLTVCTIPRPGTVGCDGD
Ga0197907_1127546913300020069Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG
Ga0206356_1036745933300020070Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG
Ga0206356_1038684923300020070Corn, Switchgrass And Miscanthus RhizosphereVNNDKRVLAPQGAKELTPGEADHVVGGISTLTVCTIPRPGTVGCDGDTT
Ga0206349_106265523300020075Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTSSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG
Ga0206354_1166959413300020081Corn, Switchgrass And Miscanthus RhizosphereMSDDKRVLARTGARELTPSEADHVNGSISTLTVCTIPRPGTIGCDGDTTG
Ga0154015_116432423300020610Corn, Switchgrass And Miscanthus RhizosphereMSDDKRVLARTGARELTPSEADHVNGSISTLTVCTIPRPGTVGCDGDTTG
Ga0126371_1026295613300021560Tropical Forest SoilMNNDKRVLGRQGARELAPGEADHVNGGISTLSVCTIPRPGTHGCDGDSLT
Ga0126371_1166637933300021560Tropical Forest SoilMNNDKRVLARRGAKELTPNEADHVNGGIITLFTLCTIPRPGTVGCDGDTTG
Ga0126371_1219361213300021560Tropical Forest SoilMNNDKRVLGRQGAKELTPSETDHVMGGIVTLLTVCTIPQPGMQGCDGDKSF
Ga0126371_1236788713300021560Tropical Forest SoilMNNDKRVLGRKGAKELTPSETDHVIGGISTLLSVCTIPRPGTVGCDGDRGT
Ga0224712_1051916333300022467Corn, Switchgrass And Miscanthus RhizosphereVNNDKRVLARQGAKELTPGEADHVVGGISTLTVCTIPRPGTVGCDGDT
Ga0224712_1066876423300022467Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGAKELTPSEADHVVGGLSTLTVCTI
Ga0242658_115137823300022530SoilMNNDKRVLGRQGAKELTPNEADHVIGGIATRLTVCTIPRPGMQGCDGDTTS
Ga0242660_111737323300022531SoilMNNDNRVLGRQGAKELTPSETDHVIGGISTLLSVCTIPRPGTVGCDGDKGT
Ga0207692_1004066133300025898Corn, Switchgrass And Miscanthus RhizosphereMNDDKRVLARQGAKELTSSEADHVVGGLSTLTVCTIPRPGTHGCDGDTTG
Ga0207685_1011689323300025905Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARQGAKELTPSEADHVNGGIITRLSVCTIPRPGTVGCDGDVTS
Ga0207685_1058110513300025905Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLGRQGARELAPSEADHVVGGLSTLTVCTIPRPGTHGC
Ga0207695_1031708823300025913Corn RhizosphereMNNEKRVLGRQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG
Ga0207693_1079410523300025915Corn, Switchgrass And Miscanthus RhizosphereMNNDKRVLARRGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG
Ga0207660_1011759923300025917Corn RhizosphereVNNDKRVLARQGAKELTPGEADHVVGGISTLTVCTIPRPGTVGCDGDTTG
Ga0207687_1111174523300025927Miscanthus RhizosphereNKKGEKHMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG
Ga0207702_1201780623300026078Corn RhizosphereTRRKKHMNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG
Ga0209177_1051290923300027775Agricultural SoilMDNDKRVLARLGAKELTPSEADHVNGGIITRLSVCTIPRPGTV
Ga0209811_1005520923300027821Surface SoilMNNDKRVLGRRGAKELTPSETDHVNGGIATLLSVCTIPRPGTVGCDGDVTT
Ga0209580_1001938923300027842Surface SoilMNNDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTVGCDGDTTG
Ga0209580_1057767123300027842Surface SoilMNNDKRVLARQGAKELTSSEADHVVGGFSTLTVCTIPRPGTTGCDGDTTG
Ga0209166_1009741633300027857Surface SoilMNNDKRVLGRQGAKELTPSEADHVNGGITTRLTVCTIPRPGTTGCDGDTTS
Ga0075386_1216568333300030916SoilMNNDKRVLGRQGARELAPSEADHVNGGIITRLSVCTIPRPGTTGCD
Ga0075373_1164447123300030945SoilMNNDKRVLGRQGAKELTPGEADHVIGGIITRLSLCTIPRPGTTGCDGDTTG
Ga0075379_1083798923300030946SoilMNNDKRVLGRQGAKELTPGEADHVIGGIATRLTVCTIPRPGTTGCDGDTGS
Ga0170834_10689817323300031057Forest SoilMNNDKRVLGRQGAKELTPSEADHVIGGIATRLTVCTIPRPGTTGCDGDTGS
Ga0170824_11536876123300031231Forest SoilMNNDKRVLARQGAKELTPSEADHVVGGLSTLTVCTIPRPGTTGCDGDTTG
Ga0308175_10024300523300031938SoilVNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG
Ga0308176_1151486723300031996SoilNNDKRVLARQGAKELTPSEADHVVGGFSTLTVCTIPRPGTVGCDGDTTG
Ga0306920_10254510923300032261SoilMNNDKRVLGRQGAKELTPSETDHVMGGVITLLTVCTIPQPGMQGCDGDKSF
Ga0310810_1112111013300033412SoilVLARLGAKELTPSEADHVNGGIITRLSVCTIPRPGTVGCDGDTTS
Ga0310811_1044825713300033475SoilMDNAKRVLARLGAKELTPSEADHVNGGIITRLSVCTIPRPGTVGCDGDTTS

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.