NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106026

Metagenome / Metatranscriptome Family F106026

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106026
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 44 residues
Representative Sequence MNEHEQLVDRAARHAHTVLFLGGLDAGKSTLARATAAFALRLGR
Number of Associated Samples 96
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 97.00 %
% of genes near scaffold ends (potentially truncated) 96.00 %
% of genes from short scaffolds (< 2000 bps) 95.00 %
Associated GOLD sequencing projects 95
AlphaFold2 3D model prediction Yes
3D model pTM-score0.37

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (99.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(24.000 % of family members)
Environment Ontology (ENVO) Unclassified
(33.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 55.56%    β-sheet: 0.00%    Coil/Unstructured: 44.44%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.37
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF12728HTH_17 66.00
PF15698Phosphatase 21.00
PF00941FAD_binding_5 3.00
PF03205MobB 1.00
PF00106adh_short 1.00
PF02604PhdYeFM_antitox 1.00
PF03160Calx-beta 1.00
PF00850Hist_deacetyl 1.00
PF03450CO_deh_flav_C 1.00
PF01799Fer2_2 1.00
PF13649Methyltransf_25 1.00
PF02738MoCoBD_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG0123Acetoin utilization deacetylase AcuC or a related deacetylaseSecondary metabolites biosynthesis, transport and catabolism [Q] 2.00
COG1763Molybdopterin-guanine dinucleotide biosynthesis proteinCoenzyme transport and metabolism [H] 1.00
COG2161Antitoxin component YafN of the YafNO toxin-antitoxin module, PHD/YefM familyDefense mechanisms [V] 1.00
COG4118Antitoxin component of toxin-antitoxin stability system, DNA-binding transcriptional repressorDefense mechanisms [V] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.00 %
UnclassifiedrootN/A1.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908041|P3_CLC_ConsensusfromContig12469All Organisms → cellular organisms → Bacteria645Open in IMG/M
3300000955|JGI1027J12803_108718346All Organisms → cellular organisms → Bacteria833Open in IMG/M
3300001977|JGI24746J21847_1058862All Organisms → cellular organisms → Bacteria548Open in IMG/M
3300003996|Ga0055467_10164230All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales671Open in IMG/M
3300004070|Ga0055488_10005593All Organisms → cellular organisms → Bacteria1856Open in IMG/M
3300004643|Ga0062591_102544069All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300005146|Ga0066817_1029287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300005175|Ga0066673_10895656All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium505Open in IMG/M
3300005331|Ga0070670_100749368All Organisms → cellular organisms → Bacteria880Open in IMG/M
3300005343|Ga0070687_101088220All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales584Open in IMG/M
3300005364|Ga0070673_101843613All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium573Open in IMG/M
3300005445|Ga0070708_102156508All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300005455|Ga0070663_101627998All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium576Open in IMG/M
3300005471|Ga0070698_101337281All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia667Open in IMG/M
3300005535|Ga0070684_100573859All Organisms → cellular organisms → Bacteria1048Open in IMG/M
3300005545|Ga0070695_101017286All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300005713|Ga0066905_102056728All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium531Open in IMG/M
3300006163|Ga0070715_10013443All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia3008Open in IMG/M
3300006577|Ga0074050_11641066All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300006581|Ga0074048_13104011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300006581|Ga0074048_13423632All Organisms → cellular organisms → Bacteria911Open in IMG/M
3300006605|Ga0074057_12100768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium592Open in IMG/M
3300006797|Ga0066659_10237772All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Streptosporangiaceae1356Open in IMG/M
3300006881|Ga0068865_100519916All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales995Open in IMG/M
3300006953|Ga0074063_12967148All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Actinomycetales643Open in IMG/M
3300007004|Ga0079218_12368374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → Streptosporangiales → Thermomonosporaceae → Actinomadura623Open in IMG/M
3300009012|Ga0066710_104157578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium541Open in IMG/M
3300009811|Ga0105084_1036296All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Rokubacteria → unclassified Candidatus Rokubacteria → Candidatus Rokubacteria bacterium852Open in IMG/M
3300010045|Ga0126311_10649167All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria839Open in IMG/M
3300010329|Ga0134111_10452084All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium557Open in IMG/M
3300010362|Ga0126377_13369064All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300010366|Ga0126379_11118964All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium893Open in IMG/M
3300010371|Ga0134125_12964452All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium515Open in IMG/M
3300010375|Ga0105239_13335111All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium522Open in IMG/M
3300010401|Ga0134121_10075855All Organisms → cellular organisms → Bacteria2787Open in IMG/M
3300012200|Ga0137382_11009685All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium597Open in IMG/M
3300012211|Ga0137377_11621150All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium570Open in IMG/M
3300012680|Ga0136612_10013333All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia4077Open in IMG/M
3300012896|Ga0157303_10290702All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300012901|Ga0157288_10076181All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria854Open in IMG/M
3300012908|Ga0157286_10432097All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium519Open in IMG/M
3300012918|Ga0137396_10884019All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300012951|Ga0164300_10879108All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium564Open in IMG/M
3300012951|Ga0164300_10921809All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium554Open in IMG/M
3300012955|Ga0164298_10796146All Organisms → cellular organisms → Bacteria675Open in IMG/M
3300012958|Ga0164299_10305709All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria980Open in IMG/M
3300012984|Ga0164309_11645824All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium550Open in IMG/M
3300012985|Ga0164308_10544710All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria978Open in IMG/M
3300014268|Ga0075309_1089238All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria741Open in IMG/M
3300015372|Ga0132256_100274410All Organisms → cellular organisms → Bacteria1763Open in IMG/M
3300018078|Ga0184612_10222420All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium978Open in IMG/M
3300018465|Ga0190269_11180871All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium599Open in IMG/M
3300018920|Ga0190273_11287494All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium629Open in IMG/M
3300020059|Ga0193745_1065594All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria793Open in IMG/M
3300022208|Ga0224495_10399219All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium539Open in IMG/M
3300022915|Ga0247790_10201908All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium529Open in IMG/M
3300025313|Ga0209431_10160865All Organisms → cellular organisms → Bacteria1777Open in IMG/M
3300025322|Ga0209641_10932135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium571Open in IMG/M
3300025325|Ga0209341_10475492All Organisms → cellular organisms → Bacteria1000Open in IMG/M
3300025535|Ga0207423_1064462All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria655Open in IMG/M
3300025558|Ga0210139_1079338All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M
3300025898|Ga0207692_10195257All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1187Open in IMG/M
3300025901|Ga0207688_10774727All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium608Open in IMG/M
3300025930|Ga0207701_11571820All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium530Open in IMG/M
3300025937|Ga0207669_11651463All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium547Open in IMG/M
3300025938|Ga0207704_10480903All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium997Open in IMG/M
3300025940|Ga0207691_10980719All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria706Open in IMG/M
3300025996|Ga0208777_1002886All Organisms → cellular organisms → Bacteria1507Open in IMG/M
3300026035|Ga0207703_11837454All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium582Open in IMG/M
3300026071|Ga0208537_1020562All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium836Open in IMG/M
3300026089|Ga0207648_10181125All Organisms → cellular organisms → Bacteria1865Open in IMG/M
3300027379|Ga0209842_1068199All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium628Open in IMG/M
3300027882|Ga0209590_10284473Not Available1060Open in IMG/M
3300027909|Ga0209382_12157861All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium528Open in IMG/M
3300027910|Ga0209583_10739051All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300028379|Ga0268266_10610276All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria1048Open in IMG/M
3300028596|Ga0247821_10307994All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria967Open in IMG/M
3300028704|Ga0307321_1117911All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium548Open in IMG/M
3300028713|Ga0307303_10097676All Organisms → cellular organisms → Bacteria670Open in IMG/M
3300028717|Ga0307298_10007488All Organisms → cellular organisms → Bacteria2674Open in IMG/M
3300028768|Ga0307280_10375507All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium527Open in IMG/M
3300028771|Ga0307320_10247455All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria702Open in IMG/M
3300028802|Ga0307503_10310954All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium794Open in IMG/M
3300028802|Ga0307503_10665705All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium581Open in IMG/M
3300028875|Ga0307289_10002495All Organisms → cellular organisms → Bacteria7537Open in IMG/M
3300028875|Ga0307289_10429821All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium543Open in IMG/M
3300028878|Ga0307278_10137372All Organisms → cellular organisms → Bacteria1096Open in IMG/M
3300028881|Ga0307277_10565664All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium510Open in IMG/M
3300030002|Ga0311350_11122962All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria701Open in IMG/M
3300031229|Ga0299913_11368847All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium663Open in IMG/M
3300031547|Ga0310887_11070173All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium517Open in IMG/M
3300031908|Ga0310900_11389432All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria589Open in IMG/M
3300031911|Ga0307412_11727579All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium574Open in IMG/M
3300032017|Ga0310899_10187946All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria907Open in IMG/M
3300032122|Ga0310895_10570792All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium577Open in IMG/M
3300032174|Ga0307470_11090717All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium641Open in IMG/M
3300032275|Ga0315270_10639692All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria693Open in IMG/M
3300033412|Ga0310810_10998427All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria716Open in IMG/M
3300033418|Ga0316625_101470235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria643Open in IMG/M
3300033500|Ga0326730_1068096All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria671Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil24.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil6.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil5.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere5.00%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands4.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil4.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil3.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere3.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere3.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil2.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.00%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands2.00%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand2.00%
Corn, Switchgrass And Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere2.00%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment1.00%
Polar Desert SandEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Polar Desert Sand1.00%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment1.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment1.00%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds1.00%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.00%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere1.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.00%
Rice Paddy SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Rice Paddy Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere1.00%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen1.00%
Peat SoilEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Peat Soil1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere1.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.00%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908041Permafrost microbial communities from permafrost in Bonanza Creek, Alaska - Permafrost Layer P3EnvironmentalOpen in IMG/M
3300000955Soil microbial communities from Great Prairies - Iowa, Native Prairie soilEnvironmentalOpen in IMG/M
3300001977Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5Host-AssociatedOpen in IMG/M
3300003996Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_CattailB_D2EnvironmentalOpen in IMG/M
3300004070Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - RushOxbow_ThreeSqA_D2EnvironmentalOpen in IMG/M
3300004643Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Combined assembly of AARS Block 3EnvironmentalOpen in IMG/M
3300005146Soil and rhizosphere microbial communities from Laval, Canada - mgHABEnvironmentalOpen in IMG/M
3300005175Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122EnvironmentalOpen in IMG/M
3300005331Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaGHost-AssociatedOpen in IMG/M
3300005343Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaGEnvironmentalOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005445Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaGEnvironmentalOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005535Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaGEnvironmentalOpen in IMG/M
3300005545Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaGEnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006577Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHPA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006581Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006605Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHAB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006797Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_108EnvironmentalOpen in IMG/M
3300006881Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2Host-AssociatedOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007004Agricultural soil microbial communities from Utah to study Nitrogen management - NC CompostEnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009811Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_20_30EnvironmentalOpen in IMG/M
3300010045Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot61EnvironmentalOpen in IMG/M
3300010329Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_D_Rain_40cm_2_11112015EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010366Tropical forest soil microbial communities from Panama - MetaG Plot_24EnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010401Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-1EnvironmentalOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012211Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012680Polar desert sand microbial communities from Dry Valleys, Antarctica - metaG UQ224A (23.06)EnvironmentalOpen in IMG/M
3300012896Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S118-311C-2EnvironmentalOpen in IMG/M
3300012901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S119-311C-1EnvironmentalOpen in IMG/M
3300012908Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-S089-202R-1EnvironmentalOpen in IMG/M
3300012918Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czcobulk3.16 metaGEnvironmentalOpen in IMG/M
3300012951Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_226_MGEnvironmentalOpen in IMG/M
3300012955Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_216_MGEnvironmentalOpen in IMG/M
3300012958Unamended control soil microbial communities from upstate New York, USA - Whitman soil sample_221_MGEnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012985Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_246_MGEnvironmentalOpen in IMG/M
3300014268Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNE_CattailA_D1EnvironmentalOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300018078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_60_coexEnvironmentalOpen in IMG/M
3300018465Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 ISEnvironmentalOpen in IMG/M
3300018920Populus adjacent soil microbial communities from riparian zone of Shoshone River, Wyoming, USA - 504 ISEnvironmentalOpen in IMG/M
3300020059Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L1a2EnvironmentalOpen in IMG/M
3300022208Sediment microbial communities from San Francisco Bay, California, United States - SF_Jul11_sed_USGS_4_1EnvironmentalOpen in IMG/M
3300022915Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S171-409R-4EnvironmentalOpen in IMG/M
3300025313Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_3 (SPAdes)EnvironmentalOpen in IMG/M
3300025322Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 16_1 (SPAdes)EnvironmentalOpen in IMG/M
3300025325Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 13_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025535Wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_ThreeSqA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300025558Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - Browns_TuleB_D2 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025901Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes)Host-AssociatedOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025940Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025996Rice paddy soil microbial communities from Twitchell Island, California, USA - SF_Rice_20C_0N_301 (SPAdes)EnvironmentalOpen in IMG/M
3300026035Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026071Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_TuleA_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026089Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300027379Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 (SPAdes)EnvironmentalOpen in IMG/M
3300027882Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con1.8 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300028379Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300028596Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_Glycerol_Day14EnvironmentalOpen in IMG/M
3300028704Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_379EnvironmentalOpen in IMG/M
3300028713Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_184EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028768Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_119EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028802Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 17_SEnvironmentalOpen in IMG/M
3300028875Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_143EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300028881Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_116EnvironmentalOpen in IMG/M
3300030002II_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031229Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT155D38EnvironmentalOpen in IMG/M
3300031547Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60D4EnvironmentalOpen in IMG/M
3300031908Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C24D1EnvironmentalOpen in IMG/M
3300031911Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1Host-AssociatedOpen in IMG/M
3300032017Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C8D4EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032174Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_05EnvironmentalOpen in IMG/M
3300032275Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C1_bottomEnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033418Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_T1_C1_D1_AEnvironmentalOpen in IMG/M
3300033500Lab enriched peat soil microbial communities from Michigan Hollow, Ithaca, NY, United States - MHF7AN SIP fractionEnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
P3_CLC_011793702124908041SoilMNEHEQLVDRAARHARTVLFLGGMDAGKSTLARATAAFALRIGRSVAYLH
JGI1027J12803_10871834623300000955SoilMNEHEQLVDHAARHARSVLFLGGLDAGKSTLARATAAFALRLGRTVAYIDADV
JGI24746J21847_105886223300001977Corn, Switchgrass And Miscanthus RhizosphereMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFALRIGRSVAYIDADVA
Ga0055467_1016423013300003996Natural And Restored WetlandsLNEHDRLVDRAAREARTVLFVGGLDAGKSTLARATAAFALR
Ga0055488_1000559343300004070Natural And Restored WetlandsVNEHDRLVDRAAREARTVLFVGGLDAGKSTLARATAAFALRQGRTV
Ga0062591_10254406913300004643SoilVGLEALFMNEHEQLVDRAARHAHTALFLGGLDAGKSTLARAT
Ga0066817_102928723300005146SoilVNEHDRLVDRAARDAHTVLFIGGLDAGKSTLARAVCAYALSL
Ga0066673_1089565613300005175SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIGRRV
Ga0070670_10074936813300005331Switchgrass RhizosphereMNEHEQLVDRAARHAHTVLFLGGMDAGKSTLARATAAFALRVGRSVAYI
Ga0070687_10108822013300005343Switchgrass RhizosphereVGLEALSMNEHEQLVDRAARHAHTVLFLGGLDAGKSTLAR
Ga0070673_10184361333300005364Switchgrass RhizosphereVNEHDRLVDRAARDAHTVLFIGGLDAGKSTLARAVCAYALSLRR
Ga0070708_10215650823300005445Corn, Switchgrass And Miscanthus RhizosphereMNEHEQLVDRAARHAHTVLFLGGLDAGKSTLARATAAFALRLGR
Ga0070663_10162799813300005455Corn RhizosphereVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARATAAYALRRG
Ga0070698_10133728133300005471Corn, Switchgrass And Miscanthus RhizosphereVNEHDRLVDRAARDAHTVLFVGGIDAGKSTLARAVCAYALSLGRSVVYIDG
Ga0070684_10057385913300005535Corn RhizosphereMNEHEQLVDRAARHAHTVLFLGGMDAGKSTLARATAAFALRVGRSVAYIDADV
Ga0070695_10101728633300005545Corn, Switchgrass And Miscanthus RhizosphereMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALR
Ga0066905_10205672833300005713Tropical Forest SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFA
Ga0070715_1001344363300006163Corn, Switchgrass And Miscanthus RhizosphereMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAA
Ga0074050_1164106613300006577SoilVNEHDRLVDRAARDARTVMFIGGLDSGKSTLARATAAFALRLGRS
Ga0074048_1310401123300006581SoilVNEHDRLVDRAARDAHTVLFVGGIDAGKSTLARAVSAYALTLG
Ga0074048_1342363233300006581SoilMNEHEQLVDQAARRAGTALFLGGLDSGKSTLARATAAFALRLGRTVAYLDA
Ga0074057_1210076833300006605SoilVNEHDRLVDRAARDARTVMFIGGLDSGESTLARATAAFALRLGRSV
Ga0066659_1023777213300006797SoilVNEHDRLVDRAAHEARTVLFIGGLDAGKSTLARAVAAYALHLGRT
Ga0068865_10051991613300006881Miscanthus RhizosphereVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARATAAYA
Ga0074063_1296714833300006953SoilVNEHDRLVSRAARDAHTVLFIGGLESGKSTLARATGAFA
Ga0079218_1236837433300007004Agricultural SoilMNEHERLVDRAAREARTVLFVGGLDAGKSTLARATAAFALRRGRTVAYL
Ga0066710_10415757813300009012Grasslands SoilMNEHEQLVDHAARHARSVLFLGGLDAGKSTLARATAAF
Ga0105084_103629613300009811Groundwater SandMNEHDRLVDRAAREARTVLFVGGLDSGKSSMARAVAAYALHVGRSVAYL
Ga0126311_1064916713300010045Serpentine SoilVIEEVLSMNEHELLVDRAARHAHTVLFLGGLDAGKSTIARATAAFALRLGR
Ga0134111_1045208413300010329Grasslands SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRLGRSV
Ga0126377_1336906433300010362Tropical Forest SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRL
Ga0126379_1111896413300010366Tropical Forest SoilMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFALRIGRSVAYIDADV
Ga0134125_1296445223300010371Terrestrial SoilMNEHDRLVDRAAREARSVLFVGGLDSGKSSMARATEAHALRL
Ga0105239_1333511133300010375Corn RhizosphereMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATA
Ga0134121_1007585513300010401Terrestrial SoilMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFA
Ga0137382_1100968533300012200Vadose Zone SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIGRRVAYID
Ga0137377_1162115013300012211Vadose Zone SoilVNEHDRLVDRAAHEARTVLFIGGLDAGKSTLARAVAAYALHL
Ga0136612_1001333313300012680Polar Desert SandMNEHDRLVDRAAREARIVMFVGGLDAGKSTLARATAAFALRRGRTV
Ga0157303_1029070223300012896SoilMNEHEQLVDRAARHAHTVLFLGGLDAGKSTLARATAAFALRLGRSVAYIDAD
Ga0157288_1007618133300012901SoilVDDGGSVVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARA
Ga0157286_1043209713300012908SoilMNEHEQLVDRAARHAHTVLFLGSMDAGKSTLARATAAFALRVGRSVAY
Ga0137396_1088401933300012918Vadose Zone SoilVNEHDRLEDRAARDAHTVLFVGGLDAGKSTLARAVAAYALSLG
Ga0164300_1087910833300012951SoilVNEHDRLVDRAARDAHTVLFIGGLDAGKSTLARAVCAYALSLR
Ga0164300_1092180913300012951SoilMNEHEQLVDRAARHAHTVLFLGGLDAGKSTLARATAAFALRL
Ga0164298_1079614613300012955SoilMNEHEQLVDRAARHARSVLFLGGLDAGKSTLARATA
Ga0164299_1030570933300012958SoilMNEHEQLVDRAARHAHTVVYLGGLDAGKSTLARATAAFALRVGRSVAYIDA
Ga0164309_1164582413300012984SoilVNEHDRLVDRAARDAHTVLFVGGIDAGKSTLARAVSAYALTLGRSVAYIDG
Ga0164308_1054471033300012985SoilMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFALRIGRSV
Ga0075309_108923833300014268Natural And Restored WetlandsMNEHERLMGEAARASLALFVGGLGSGKSTLARATCALALRLGRRAAYLDADV
Ga0132256_10027441043300015372Arabidopsis RhizosphereMTAGPPVIEEDLSMNEHELLVDRAARHAHTVLFLGGMDAGKSTIARAAA
Ga0184612_1022242013300018078Groundwater SedimentVMNEHDRLIDRAAREARAVLFVGGLDSGKSSMARATA
Ga0190269_1118087133300018465SoilMNEHDRLVDRAARDARTVLFVGGLDAGKSTLARATAAYALRLGRTV
Ga0190273_1128749433300018920SoilMNEHDRLVDRAAREARAVLFVGGLDSGKSSMARATAAYAL
Ga0193745_106559413300020059SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIGR
Ga0224495_1039921913300022208SedimentVNEHDRLVDRAAREARTVLFVGGLDAGKSTLARATAAFALR
Ga0247790_1020190833300022915SoilMNEHEQLVDRAARHAHTVLFLGSMDAGKSTLARATAA
Ga0209431_1016086543300025313SoilMNEHEQLVDRAARHAHTVLFLGGMDAGKSTLASAILGFQPH
Ga0209641_1093213513300025322SoilMNEHEQLVDRAARHAHTVLFLGGMDAGKSTLARATAAFALRL
Ga0209341_1047549233300025325SoilMNEHEQLVDRAARHAHTVLFLGGMDAGKSTLARATAAFALRLGRSV
Ga0207423_106446233300025535Natural And Restored WetlandsMNEHEQLVDQAARHARTVLFIGGMDAGKSTLARATAAFALR
Ga0210139_107933833300025558Natural And Restored WetlandsVNEHDRLVDRAARDAHTVLFVGGLDAGKSTLARAVCAYALR
Ga0207692_1019525733300025898Corn, Switchgrass And Miscanthus RhizosphereMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFALRI
Ga0207688_1077472713300025901Corn, Switchgrass And Miscanthus RhizosphereVNEHDRLVDRAARDARTVVFIGGLDAGKSTLARATAAYALRRGRTVAIELRFGPSP
Ga0207701_1157182013300025930Corn, Switchgrass And Miscanthus RhizosphereMNEHEQLVDRAARHAHTVLFLGSMDAGKSTLARATA
Ga0207669_1165146313300025937Miscanthus RhizosphereMNEHEQLVDQAARHARSVLFLGVLDAGKSTLARATAAFALRVGRRVA
Ga0207704_1048090333300025938Miscanthus RhizosphereVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARATAAYAL
Ga0207691_1098071913300025940Miscanthus RhizosphereVNEHDRLVDRAARDAHTVLFIGGLDAGKSTLARAVCAYALSLRRSVVYID
Ga0208777_100288613300025996Rice Paddy SoilVNEHDRLVDRAARDAHTVLFVGGLDAGKSTLARAVSAHALTLGRSVVYVD
Ga0207703_1183745413300026035Switchgrass RhizosphereVNEHDRLVDRAARDAHTVLFIGGLDAGKSTLARAV
Ga0208537_102056213300026071Natural And Restored WetlandsLNEHDRLVDRAAREARTVLFVGGLDAGKSTLARATAAFALRLGRSV
Ga0207648_1018112513300026089Miscanthus RhizosphereMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRV
Ga0209842_106819933300027379Groundwater SandMNEHDRLVDRAAREARAVLFVGGLDSGKSSMARATAAYALR
Ga0209590_1028447323300027882Vadose Zone SoilMNEHEQLVDQAARHARSVLFLGGLDAGRSTLARASQDR
Ga0209382_1215786113300027909Populus RhizosphereMNEHDRLVDRAAREARAVLFVGGLDSGKSSMARATAAYALTLGRS
Ga0209583_1073905133300027910WatershedsVNEHDRLVDRAARDAHTVLFVGGLDAGKSTLARAVAA
Ga0268266_1061027613300028379Switchgrass RhizosphereVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARATAA
Ga0247821_1030799433300028596SoilVNEHDRLVDRAARDARTVLFVGGLDAGKSTLARATAAFALRLGRTVAYLDADGLLRDVGIEVG
Ga0307321_111791123300028704SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIGRRVTYIDA
Ga0307303_1009767633300028713SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIGRRVA
Ga0307298_1000748813300028717SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIG
Ga0307280_1037550713300028768SoilMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFALRVGRSVAYIDAD
Ga0307320_1024745513300028771SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATAAFALRIGRR
Ga0307503_1031095433300028802SoilMNEHDRLVDRAARDAHTVLFIGGLDAGKSTLARATAAYAL
Ga0307503_1066570513300028802SoilVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARATAAY
Ga0307289_10002495103300028875SoilMNEHEQLVDQAARHARSVLFLGGLDAGKSTLARATA
Ga0307289_1042982113300028875SoilMNEHDRLVDRAAREARAVLFVGGLDSGKSSMARATAAFALRLGRSVA
Ga0307278_1013737213300028878SoilMNEHEQLVDRAARHARSVLFLGGLDAGKSTLARATAAFALRIGRRVAYID
Ga0307277_1056566413300028881SoilMNEHDRLVDRAAREARAVLFVGGLDSGKSSMARATAAFALRL
Ga0311350_1112296213300030002FenVNEHDRLVSRAARDAHTVLFIGGLESGKSTLARATGAFALRLGRTVAYLDADVAQ
Ga0299913_1136884723300031229SoilMNEHDRLVDRAAREARTVLFVGGLDSGKSSMARATAAYALHLGRSVAYL
Ga0310887_1107017313300031547SoilVNEHDRLVDRAAREARTVVFIGGLDAGKSTLARATAAYALRRGRTVAY
Ga0310900_1138943213300031908SoilMNEHEQLVDHAARDARTVLFIGGMDSGKSTLARATAAFAL
Ga0307412_1172757923300031911RhizosphereMNEHDRLVDRAAREARSVMFVGGLDSGKSSLARAVAAYALRLGRSVAYLD
Ga0310899_1018794613300032017SoilMNEHDRLVDRAAHEARTVLFVGGLDSGKSSMARAIAAYALRLGRSVAYL
Ga0310895_1057079223300032122SoilMNEHEQLVDRAARHAHTVLFLGGMDAGKSTLARATAAFALRVGRSVA
Ga0307470_1109071733300032174Hardwood Forest SoilVNEHDRLVDRAAREARTVLFIGGIDAGKSTLARATAAYALRRGRTVAYLD
Ga0315270_1063969213300032275SedimentVNEHDRLVDRAARDAHTVLFIGGIDAGKSTLARAVAAFALRLGRSVAYLDAD
Ga0310810_1099842713300033412SoilMNEHEQLVDRAARHAHTVVFLGGLDAGKSTLARATAAFALRIGRSVAYID
Ga0316625_10147023513300033418SoilMNEHEQLVDRAARHARTVLFIGGLDAGKSTLARATAAYALR
Ga0326730_106809633300033500Peat SoilMNEHEQLVDRAARHARTVLFLGGLDSGKSTLARATAAFALRIGRSVAYIDA

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.