NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F106043

Metagenome / Metatranscriptome Family F106043

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F106043
Family Type Metagenome / Metatranscriptome
Number of Sequences 100
Average Sequence Length 46 residues
Representative Sequence MRTGIGIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP
Number of Associated Samples 92
Number of Associated Scaffolds 100

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Unclassified
% of genes with valid RBS motifs 58.00 %
% of genes near scaffold ends (potentially truncated) 48.00 %
% of genes from short scaffolds (< 2000 bps) 93.00 %
Associated GOLD sequencing projects 90
AlphaFold2 3D model prediction Yes
3D model pTM-score0.43

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Unclassified (60.000 % of family members)
NCBI Taxonomy ID N/A
Taxonomy N/A

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil
(35.000 % of family members)
Environment Ontology (ENVO) Unclassified
(37.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(44.000 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Transmembrane (alpha-helical) Signal Peptide: Yes Secondary Structure distribution: α-helix: 49.28%    β-sheet: 0.00%    Coil/Unstructured: 50.72%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.43
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 100 Family Scaffolds
PF03401TctC 5.00
PF13193AMP-binding_C 5.00
PF09992NAGPA 3.00
PF04392ABC_sub_bind 2.00
PF12773DZR 2.00
PF10038DUF2274 1.00
PF13505OMP_b-brl 1.00
PF13701DDE_Tnp_1_4 1.00
PF13432TPR_16 1.00
PF03006HlyIII 1.00
PF10905DUF2695 1.00
PF12706Lactamase_B_2 1.00
PF05974DUF892 1.00
PF02738MoCoBD_1 1.00

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 100 Family Scaffolds
COG3181Tripartite-type tricarboxylate transporter, extracytoplasmic receptor component TctCEnergy production and conversion [C] 5.00
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 2.00
COG1272Predicted membrane channel-forming protein YqfA, hemolysin III familyIntracellular trafficking, secretion, and vesicular transport [U] 1.00
COG3685Ferritin-like metal-binding protein YciEInorganic ion transport and metabolism [P] 1.00

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
UnclassifiedrootN/A60.00 %
All OrganismsrootAll Organisms40.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2199352025|deepsgr__Contig_184662All Organisms → cellular organisms → Bacteria1467Open in IMG/M
3300001661|JGI12053J15887_10021212All Organisms → cellular organisms → Bacteria → Proteobacteria3635Open in IMG/M
3300004114|Ga0062593_100339650All Organisms → cellular organisms → Bacteria1306Open in IMG/M
3300004153|Ga0063455_101276808Not Available557Open in IMG/M
3300004480|Ga0062592_101392870Not Available667Open in IMG/M
3300005093|Ga0062594_102934147Not Available532Open in IMG/M
3300005162|Ga0066814_10098839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria544Open in IMG/M
3300005168|Ga0066809_10040885All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1013Open in IMG/M
3300005332|Ga0066388_100106227All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3288Open in IMG/M
3300005713|Ga0066905_100345702All Organisms → cellular organisms → Bacteria → Proteobacteria1186Open in IMG/M
3300005713|Ga0066905_102001493Not Available537Open in IMG/M
3300006028|Ga0070717_10950955Not Available782Open in IMG/M
3300006048|Ga0075363_100777537Not Available581Open in IMG/M
3300009100|Ga0075418_11182108All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium829Open in IMG/M
3300009156|Ga0111538_13267422Not Available564Open in IMG/M
3300009156|Ga0111538_13598847Not Available537Open in IMG/M
3300010043|Ga0126380_11166561Not Available661Open in IMG/M
3300010047|Ga0126382_10158371Not Available1560Open in IMG/M
3300010047|Ga0126382_10728772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium835Open in IMG/M
3300010147|Ga0126319_1484015Not Available627Open in IMG/M
3300010362|Ga0126377_10255633All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1708Open in IMG/M
3300010397|Ga0134124_10604642All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1075Open in IMG/M
3300010403|Ga0134123_10244223Not Available1558Open in IMG/M
3300011000|Ga0138513_100029782All Organisms → cellular organisms → Bacteria789Open in IMG/M
3300012212|Ga0150985_113191692Not Available685Open in IMG/M
3300012356|Ga0137371_11042151All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria618Open in IMG/M
3300012469|Ga0150984_119820155Not Available741Open in IMG/M
3300012491|Ga0157329_1033302Not Available546Open in IMG/M
3300012683|Ga0137398_10579378Not Available775Open in IMG/M
3300012938|Ga0162651_100044064Not Available689Open in IMG/M
3300012971|Ga0126369_13647425Not Available504Open in IMG/M
3300012984|Ga0164309_11590708Not Available560Open in IMG/M
3300012986|Ga0164304_10669853Not Available784Open in IMG/M
3300012989|Ga0164305_10929280Not Available733Open in IMG/M
3300013105|Ga0157369_11980192Not Available591Open in IMG/M
3300013297|Ga0157378_10205444Not Available1865Open in IMG/M
3300014968|Ga0157379_10713709Not Available942Open in IMG/M
3300014969|Ga0157376_11178770Not Available794Open in IMG/M
3300015371|Ga0132258_10112946All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales6436Open in IMG/M
3300015371|Ga0132258_12153588Not Available1401Open in IMG/M
3300015372|Ga0132256_101665372Not Available747Open in IMG/M
3300015374|Ga0132255_102298226Not Available823Open in IMG/M
3300018027|Ga0184605_10068293All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1536Open in IMG/M
3300018028|Ga0184608_10228739Not Available817Open in IMG/M
3300018028|Ga0184608_10249610All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7781Open in IMG/M
3300018054|Ga0184621_10285962Not Available583Open in IMG/M
3300018067|Ga0184611_1132410Not Available878Open in IMG/M
3300018072|Ga0184635_10365402Not Available552Open in IMG/M
3300018469|Ga0190270_10129183All Organisms → cellular organisms → Bacteria2006Open in IMG/M
3300018476|Ga0190274_13290850Not Available544Open in IMG/M
3300018482|Ga0066669_10455268Not Available1099Open in IMG/M
3300019767|Ga0190267_11078743Not Available574Open in IMG/M
3300020000|Ga0193692_1110139Not Available571Open in IMG/M
3300020016|Ga0193696_1031248All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1425Open in IMG/M
3300021082|Ga0210380_10032484All Organisms → cellular organisms → Bacteria → Acidobacteria → Acidobacteriia → Candidatus Acidoferrales → Candidatus Acidoferrum → Candidatus Acidoferrum panamensis2234Open in IMG/M
3300022530|Ga0242658_1251077Not Available500Open in IMG/M
3300022756|Ga0222622_10479741Not Available886Open in IMG/M
3300022756|Ga0222622_11238131Not Available549Open in IMG/M
3300025925|Ga0207650_10472354All Organisms → cellular organisms → Bacteria1046Open in IMG/M
3300025944|Ga0207661_11149599Not Available715Open in IMG/M
3300025986|Ga0207658_11571019Not Available602Open in IMG/M
3300026075|Ga0207708_11049556Not Available709Open in IMG/M
3300027383|Ga0209213_1051573All Organisms → cellular organisms → Bacteria776Open in IMG/M
3300027616|Ga0209106_1017958All Organisms → cellular organisms → Bacteria1526Open in IMG/M
3300027903|Ga0209488_11117833Not Available537Open in IMG/M
3300027909|Ga0209382_11002637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiales incertae sedis → Pseudorhodoplanes → Pseudorhodoplanes sinuspersici870Open in IMG/M
3300028707|Ga0307291_1029025All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae → unclassified Hyphomicrobiaceae → Hyphomicrobiaceae bacterium1287Open in IMG/M
3300028708|Ga0307295_10101867All Organisms → cellular organisms → Bacteria774Open in IMG/M
3300028708|Ga0307295_10115173Not Available731Open in IMG/M
3300028710|Ga0307322_10146512All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria627Open in IMG/M
3300028716|Ga0307311_10233762Not Available544Open in IMG/M
3300028721|Ga0307315_10034965All Organisms → cellular organisms → Bacteria → Proteobacteria1356Open in IMG/M
3300028755|Ga0307316_10044170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1486Open in IMG/M
3300028787|Ga0307323_10125700All Organisms → cellular organisms → Bacteria923Open in IMG/M
3300028793|Ga0307299_10004974All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales4602Open in IMG/M
3300028803|Ga0307281_10126542Not Available880Open in IMG/M
3300028810|Ga0307294_10121018All Organisms → cellular organisms → Bacteria848Open in IMG/M
3300028811|Ga0307292_10488677Not Available527Open in IMG/M
3300028819|Ga0307296_10252418All Organisms → cellular organisms → Bacteria960Open in IMG/M
3300028824|Ga0307310_10008717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Hyphomicrobiaceae3859Open in IMG/M
3300028828|Ga0307312_10532165Not Available776Open in IMG/M
3300028876|Ga0307286_10220956Not Available690Open in IMG/M
3300028876|Ga0307286_10265873All Organisms → cellular organisms → Bacteria → Proteobacteria630Open in IMG/M
3300028878|Ga0307278_10369630Not Available631Open in IMG/M
3300030988|Ga0308183_1080105Not Available712Open in IMG/M
3300031093|Ga0308197_10227133Not Available650Open in IMG/M
3300031096|Ga0308193_1067526Not Available566Open in IMG/M
3300031099|Ga0308181_1046072Not Available812Open in IMG/M
3300031114|Ga0308187_10313268All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7593Open in IMG/M
3300031170|Ga0307498_10194622Not Available703Open in IMG/M
3300031199|Ga0307495_10243154Not Available514Open in IMG/M
3300031421|Ga0308194_10347811All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300031505|Ga0308150_1018642All Organisms → cellular organisms → Bacteria713Open in IMG/M
3300031740|Ga0307468_101618542Not Available606Open in IMG/M
3300031854|Ga0310904_10815297Not Available654Open in IMG/M
3300032000|Ga0310903_10677104Not Available555Open in IMG/M
3300032205|Ga0307472_101879884Not Available597Open in IMG/M
3300033551|Ga0247830_10943509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria688Open in IMG/M
3300034417|Ga0364941_189785All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria530Open in IMG/M
3300034817|Ga0373948_0026334All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Sphingomonadales → Erythrobacteraceae → Erythrobacter/Porphyrobacter group → Erythrobacter → unclassified Erythrobacter → Erythrobacter sp. HL-1111145Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil35.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment6.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil5.00%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere4.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.00%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil3.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil3.00%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil3.00%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil3.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere3.00%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment2.00%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil2.00%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.00%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere2.00%
SoilEnvironmental → Terrestrial → Agricultural Field → Unclassified → Unclassified → Soil2.00%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere2.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere2.00%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment1.00%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil1.00%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.00%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil1.00%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere1.00%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment1.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Avena Fatua Rhizosphere1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere1.00%
Populus EndosphereHost-Associated → Plants → Roots → Bulk Soil → Unclassified → Populus Endosphere1.00%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere1.00%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere1.00%
Rhizosphere SoilHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere Soil1.00%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Arabidopsis Rhizosphere1.00%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere1.00%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2199352025Soil microbial communities from Rothamsted, UK, for project Deep Soil - DEEP SOILEnvironmentalOpen in IMG/M
3300001661Mediterranean Blodgett CA OM1_O3 (Mediterranean Blodgett coassembly)EnvironmentalOpen in IMG/M
3300004114Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 5EnvironmentalOpen in IMG/M
3300004153Grasslands soil microbial communities from Hopland, California, USA (version 2)EnvironmentalOpen in IMG/M
3300004480Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of AARS Block 4EnvironmentalOpen in IMG/M
3300005093Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling - Combined assembly of KBS All BlocksEnvironmentalOpen in IMG/M
3300005162Soil and rhizosphere microbial communities from Laval, Canada - mgLABEnvironmentalOpen in IMG/M
3300005168Soil and rhizosphere microbial communities from Laval, Canada - mgLPCEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300006028Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaGEnvironmentalOpen in IMG/M
3300006048Populus root and rhizosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3Host-AssociatedOpen in IMG/M
3300009100Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD2Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010403Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-3EnvironmentalOpen in IMG/M
3300011000Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t6i015EnvironmentalOpen in IMG/M
3300012212Combined assembly of Hopland grassland soilHost-AssociatedOpen in IMG/M
3300012356Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300012491Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610Host-AssociatedOpen in IMG/M
3300012683Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz2.16 metaGEnvironmentalOpen in IMG/M
3300012938Agricultural soil microbial communities from Tamara ranch near Red Deer, Alberta, Canada - d1t2i015EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300012986Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_217_MGEnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013297Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaGHost-AssociatedOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300015372Soil combined assemblyHost-AssociatedOpen in IMG/M
3300015374Col-0 rhizosphere combined assemblyHost-AssociatedOpen in IMG/M
3300018027Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM0_30_coexEnvironmentalOpen in IMG/M
3300018028Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_coexEnvironmentalOpen in IMG/M
3300018054Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_30_b1EnvironmentalOpen in IMG/M
3300018067Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_coexEnvironmentalOpen in IMG/M
3300018072Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_30_b2EnvironmentalOpen in IMG/M
3300018469Populus adjacent soil microbial communities from riparian zone of Weber River, Utah, USA - 320 TEnvironmentalOpen in IMG/M
3300018476Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 531 TEnvironmentalOpen in IMG/M
3300018482Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_118EnvironmentalOpen in IMG/M
3300019767Populus adjacent soil microbial communities from riparian zone of Oak Creek, Arizona, USA - 239 TEnvironmentalOpen in IMG/M
3300020000Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300021082Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5_coex redoEnvironmentalOpen in IMG/M
3300022530Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022756Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_5_b1EnvironmentalOpen in IMG/M
3300025925Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025944Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025986Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026075Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027383Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027616Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300028707Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_148EnvironmentalOpen in IMG/M
3300028708Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_152EnvironmentalOpen in IMG/M
3300028710Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_380EnvironmentalOpen in IMG/M
3300028716Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_198EnvironmentalOpen in IMG/M
3300028721Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_355EnvironmentalOpen in IMG/M
3300028755Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_356EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028793Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_159EnvironmentalOpen in IMG/M
3300028803Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_120EnvironmentalOpen in IMG/M
3300028810Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_151EnvironmentalOpen in IMG/M
3300028811Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_149EnvironmentalOpen in IMG/M
3300028819Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_153EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028828Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_202EnvironmentalOpen in IMG/M
3300028876Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_140EnvironmentalOpen in IMG/M
3300028878Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_117EnvironmentalOpen in IMG/M
3300030988Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_157 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031093Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_198 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031099Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_152 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031114Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_182 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031170Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 12_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031421Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_195 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031505Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_139 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031854Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D1EnvironmentalOpen in IMG/M
3300032000Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D3EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300033551Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day5EnvironmentalOpen in IMG/M
3300034417Sediment microbial communities from East River floodplain, Colorado, United States - 17_s17EnvironmentalOpen in IMG/M
3300034817Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
deepsgr_031677202199352025SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP
JGI12053J15887_1002121253300001661Forest SoilMRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP*
Ga0062593_10033965033300004114SoilMRTGIGIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP*
Ga0063455_10127680823300004153SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSNWVPVTSAEMRSAAVIQPYEAGRHKAAAQ*
Ga0062592_10139287023300004480SoilMRTGIGIAIMVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP*
Ga0062594_10293414723300005093SoilMRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEA
Ga0066814_1009883913300005162SoilMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH*
Ga0066809_1004088523300005168SoilMRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH*
Ga0066388_10010622733300005332Tropical Forest SoilMLIKAQRTGIVGIAVVVALGLIWSVAVMSKWVPVASAEMRSAAVIQP*
Ga0066905_10034570223300005713Tropical Forest SoilMEAIMLTKAQRTGIVGIAVVVAIGLLWSVAVMFKWVPVANAEMRSAAVIQP*
Ga0066905_10200149323300005713Tropical Forest SoilKAQRTGIVGIAVVVAIGLLWSVAVMFKWVPVASAEMRSAAVIQP*
Ga0070717_1095095523300006028Corn, Switchgrass And Miscanthus RhizosphereMRAHRGLQMRIGIGIAVVVAIGLIWSIAVMSQWVPMASAEMRSAALIQPFEAGRR*
Ga0075363_10077753713300006048Populus EndosphereMMEGEQMRIEISIAVVVAIGLIWSVAVMSEWIPMASAELMSAAVVKP*
Ga0075418_1118210823300009100Populus RhizosphereMRTGIGIAIMVAIGLIWSVAVMSQWVPVASAEMRLAAVMEP*
Ga0111538_1326742213300009156Populus RhizosphereMRAGIVGITVVAIGLIWSVAVMSKLVPVDGSELRSTEI
Ga0111538_1359884713300009156Populus RhizosphereMEAIMLIKAQRTGIVGIAVVVAIGLIWSVAVMSKWVPVASAEMESAAVIQPYEAGRHKAAAQ*
Ga0126380_1116656113300010043Tropical Forest SoilMEAIMLIKAQRTGIVGIAVVVALGLIWAVAVMSKWVPVASAEMRSAAVIQP*
Ga0126382_1015837113300010047Tropical Forest SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMFKWVPVASAEMRSAAVIQP*
Ga0126382_1072877213300010047Tropical Forest SoilGIVGIAVVVALGLIWSVAVMSKWVPVASAEMRSAAVIQP*
Ga0126319_148401513300010147SoilAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP*
Ga0126377_1025563353300010362Tropical Forest SoilMEAIMLIKAQRTGIIGIAVVVALGLIWSVAVMSKWVPVASAEMRSAAVIQP*
Ga0134124_1060464223300010397Terrestrial SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKLVPVDGSEISLAAISRPAE*
Ga0134123_1024422313300010403Terrestrial SoilMRIGIGIAVVVAIGLIWSVAVMSQWVPVTSAEMSLAAVIQPYEAGRHKAAAQ*
Ga0138513_10002978223300011000SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP*
Ga0150985_11319169213300012212Avena Fatua RhizosphereMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSSALIQPHEANRH*
Ga0137371_1104215123300012356Vadose Zone SoilMRTGTWMGLAVVVAIGLIWSLAAMLELVPVNSAEMRSAAESPH
Ga0150984_11982015513300012469Avena Fatua RhizosphereMLINVQRAGIIGIVVVFAIGLLWSIAVMSNWVPVASAEMSSAAVLQPYEHGRQRAAAQ*
Ga0157329_103330223300012491Arabidopsis RhizosphereMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKLVPVDGSEMSSPAISRPAE*
Ga0137398_1057937813300012683Vadose Zone SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP*
Ga0162651_10004406423300012938SoilFRDTGIIWSVAVMSQWVPVASPEMRSAALIPPYETRRH*
Ga0126369_1364742523300012971Tropical Forest SoilMRAGIVGIAVVVAMGLIWSVAVMSKLVPLDGSEMRSA
Ga0164309_1159070813300012984SoilMEATMLIKVQHAGIVGIAVVVAIGLLWSVAVMSKWVPVASAEMISATVIPPYEAGRHEAAAQ*
Ga0164304_1066985313300012986SoilMEAIMLIKAQRTGIVGIAVVVALGLLWSVAVMSKLVPVDGSEISLAAISRPAE*
Ga0164305_1092928033300012989SoilMLIKAQRTGIVGIAVVVAIGLIWSVAAMSKLVPVDGSEMSSAAISRPAE*
Ga0157369_1198019223300013105Corn RhizosphereRSIAMRTGIGIAIVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH*
Ga0157378_1020544413300013297Miscanthus RhizosphereMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPPRG*
Ga0157379_1071370913300014968Switchgrass RhizosphereMRIGIGIAVVVAIGLIWSVAVMSQWVPVTSAEMSFSAVMQPYEAGRHKAAAQ*
Ga0157376_1117877013300014969Miscanthus RhizosphereTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH*
Ga0132258_1011294673300015371Arabidopsis RhizosphereMEAIMLIRAQRTGIVGIAVVVAIGLIWSVAAMSKLVPVDGSEMSSAAISRPAE*
Ga0132258_1215358823300015371Arabidopsis RhizosphereMRIGISIAVVVAIGLIWSVAVMSEWIPMASAELMSAAVVKP*
Ga0132256_10166537213300015372Arabidopsis RhizosphereMRTGISIAIVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH*
Ga0132255_10229822613300015374Arabidopsis RhizosphereMRTGISIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIQP*
Ga0184605_1006829323300018027Groundwater SedimentMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP
Ga0184608_1022873913300018028Groundwater SedimentKVQRAGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0184608_1024961023300018028Groundwater SedimentMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP
Ga0184621_1028596223300018054Groundwater SedimentMQMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP
Ga0184611_113241013300018067Groundwater SedimentMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH
Ga0184635_1036540213300018072Groundwater SedimentRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0190270_1012918313300018469SoilMRTGIGLAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPREANRR
Ga0190274_1329085013300018476SoilMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPPRG
Ga0066669_1045526823300018482Grasslands SoilMRTCIGIAVVVAIGLIWSVAVMFEWIPVNRSEMSAA
Ga0190267_1107874313300019767SoilMRIGIGMTVVVAIGLIWSIAVMSQWVPLTSVEMQSAALIQPYEAGRP
Ga0193692_111013923300020000SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP
Ga0193696_103124833300020016SoilMRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH
Ga0210380_1003248413300021082Groundwater SedimentMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0242658_125107713300022530SoilRTAIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0222622_1047974113300022756Groundwater SedimentMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQH
Ga0222622_1123813123300022756Groundwater SedimentMQMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP
Ga0207650_1047235423300025925Switchgrass RhizosphereMRTGIGIAIMVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP
Ga0207661_1114959923300025944Corn RhizosphereMRTGIGIAIVVAIGLIWSVAVMSQWVPVASAEMRSAAVIEP
Ga0207658_1157101923300025986Switchgrass RhizosphereMRTGIGIAIVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH
Ga0207708_1104955623300026075Corn, Switchgrass And Miscanthus RhizosphereIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH
Ga0209213_105157323300027383Forest SoilMRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP
Ga0209106_101795833300027616Forest SoilMQMRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP
Ga0209488_1111783313300027903Vadose Zone SoilMRTGIGIATVVAIGLIWSVAVMSQWVPVASAEMRLAAVIEP
Ga0209382_1100263733300027909Populus RhizosphereMRAGIVGIAVVVAIGLIWSVAVMSKLVPVDGSEMRSAA
Ga0307291_102902533300028707SoilAVVVAIGLIWSVAVMSQWVPVASAEMRSAAAIQTP
Ga0307295_1010186723300028708SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAE
Ga0307295_1011517323300028708SoilIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0307322_1014651213300028710SoilMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALI
Ga0307311_1023376223300028716SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0307315_1003496533300028721SoilPWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0307316_1004417043300028755SoilGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP
Ga0307323_1012570023300028787SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAV
Ga0307299_1000497483300028793SoilGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP
Ga0307281_1012654213300028803SoilSPWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0307294_1012101823300028810SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAE
Ga0307292_1048867713300028811SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRS
Ga0307296_1025241823300028819SoilMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRPAAVIQP
Ga0307310_1000871713300028824SoilIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIQTP
Ga0307312_1053216513300028828SoilGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0307286_1022095613300028876SoilQRQAEGMQMRTGMGIALLVAIGLIWSVAVMSEWVPVASAELRLAAVIKP
Ga0307286_1026587323300028876SoilERELQMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH
Ga0307278_1036963023300028878SoilIAMRTGIGIATVVAIGLIWSVAVMSQWIPVASAEMRLAAVIESR
Ga0308183_108010523300030988SoilASPWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0308197_1022713323300031093SoilAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0308193_106752613300031096SoilGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP
Ga0308181_104607233300031099SoilEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP
Ga0308187_1031326813300031114SoilTRDAEGMQMRKGIGIAVVVAMGLIWSVAVMSQWVPVASAEMRSAAAIKTP
Ga0307498_1019462213300031170SoilMLIKAQRTAIVGIAVVVAIGLLWSVAVMSKWVPLAGAEMRSAAVIQP
Ga0307495_1024315423300031199SoilPWMEAIMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPLASAEMRSAAVIQP
Ga0308194_1034781113300031421SoilRGRGIAMRTGIGIATVVAIGLIWSVAVMSQWIPVASAEMRLAAVIEP
Ga0308150_101864213300031505SoilAEGLQMRIGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSAALIQPPRG
Ga0307468_10161854223300031740Hardwood Forest SoilMEAIMLIKAQRTGIVGIAVVVAIGLIWSVAVMSKWVPVASAETRSAAVIQP
Ga0310904_1081529713300031854SoilMRTGIGIAVVVAIGLIWSVAVMSQWVPVASPEMKSATLIQ
Ga0310903_1067710413300032000SoilIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQPHEANRH
Ga0307472_10187988413300032205Hardwood Forest SoilMLIKAQRTGIVGIAVVVAIGLLWSVAVMSKWVPVTSAEMSSAAVIQPYEAGRHKAA
Ga0247830_1094350913300033551SoilMRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSAALIQP
Ga0364941_189785_421_5283300034417SedimentMRTGIGIAVLVAIGLIWSVAVMSQWVPVASPEMKSA
Ga0373948_0026334_1_1203300034817Rhizosphere SoilIGISIAVVVAIGLIWSVAVMSEWIPMASAELMSAAVVKP

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.