NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNP3_C1478

Scaffold YNP3_C1478


Overview

Basic Information
Taxon OID2014031003 Open in IMG/M
Scaffold IDYNP3_C1478 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1404
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)3 (60.00%)
Novel Protein Genes4 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (75.00%)
Associated Families4

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.7242925Long. (o)-110.7056131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F076263Metagenome / Metatranscriptome118Y
F080247Metagenome / Metatranscriptome115Y
F081547Metagenome / Metatranscriptome114Y
F087442Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
YNP3_45950F080247N/AMIVWGKTIECIIDVDVNYLNGELFNSQFRVKGKFLIFGNLYTLEKTTPGGETIQICSPVDATFMAYYQGMVAIMSFYIKEKDIYANVSLTDPDTIKEFMTMSTYYRKYGVSIPNVLDKIMYRKVPT
YNP3_45960F076263GGAMLSAEDLSAILDDLEDICARIPDSVTFHPTLEIHRHHANEEAMYIKFDCRDHKYTLTIVRNGVAKTTRVSSREQLYRRLFPEYSPGYSGSYTEEFWGGE
YNP3_45970F081547GGTGGMPYLRGVFINFGEETYYLSCGIVNGGNLDTETYTVNQPSLMMVRLGRDLYIVTSELKLIIPVEPIKTLLSSETSKVYNEMLSQGNEVKPA
YNP3_45980F087442GAGGMMREGLVKAGNLVVDCKPCYVAGTGFTKDDIYVISEGTVVFKWYDKIAVITVGEEGTKVNLLDIVDVRFLVERNENCLATRL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.