NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNP3_FUBA12882_g1

Scaffold YNP3_FUBA12882_g1


Overview

Basic Information
Taxon OID2014031003 Open in IMG/M
Scaffold IDYNP3_FUBA12882_g1 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)858
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families3

Taxonomy
All Organisms → Viruses → unclassified archaeal viruses → Nanoarchaeotal virus 1(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.7242925Long. (o)-110.7056131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F062912Metagenome / Metatranscriptome130Y
F077497Metagenome / Metatranscriptome117Y
F087443Metagenome / Metatranscriptome110Y

Sequences

Protein IDFamilyRBSSequence
YNP3_168220F077497N/AMDPEQINKIEEIIEEILERHLFEETNNPDYELKKMDVMVKYLIYQQLKELNNNLSLIDEALSIKELEK
YNP3_168230F087443N/AMGQKSIGPKKNYWMVFRDGDNVDYIEKEITKAALDLNKDVLEMRAWIFKAFAYDPEVKAKIIEYIKKNGSGTNQ
YNP3_168240F062912N/AMQCKKFINFDLHIYSMDPQVILAETYNLFLVSDIVENESDIDRELKNLLANRDYNNMAKTLIYTLMYTLNNDPAYRNIRQIYINEAIDLLYMIDRMGFDNERIMKKFVNLLYHFILIRAYKITL
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.