NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNP3A_C5087

Scaffold YNP3A_C5087


Overview

Basic Information
Taxon OID2016842001 Open in IMG/M
Scaffold IDYNP3A_C5087 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP3 Monarch Geyser, Norris Geyser Basin
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)8075
Total Scaffold Genes12 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)7 (58.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Associated Families3

Taxonomy
All Organisms → Viruses → Adnaviria → Zilligvirae → Taleaviricota → Tokiviricetes → Ligamenvirales → Lipothrixviridae → Alphalipothrixvirus(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.7242925Long. (o)-110.7056131Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F070317Metagenome / Metatranscriptome123Y
F077499Metagenome / Metatranscriptome117Y
F077502Metagenome / Metatranscriptome117N

Sequences

Protein IDFamilyRBSSequence
YNP3A_204520F077499AGGMMGDIFVFPNESLKPVSYPNITNAEIIFILTISIPIGGHPESDTPMEEKMKFLSTYTPLEFQKLYYIKTIDKALDILKHLLYTREDNVLFEIANKINSLYDVKELINKVKDVECTKDLKTLNVTLTEAKRYIYPDISLSRYASSQAKQLGIKKYEYYARLFQCYVETDKNLDMLTLFRVSNLVFNFLRINNLSHIIKKMQFKDENINKIAEKKNKG
YNP3A_204540F077502N/AVVTMTDVAHIVIWIEKNLPEEGKLSELIDNVFSLIQEIILNNLSQGKQPISFESVREIADTFKEVIYRSIEQTIGTLTEEVKEQVDAYF
YNP3A_204550F070317GAGMSAMEELKELNLERIVKDAQEGEVCVVNKILKGKLTDLMPLIKDPATLSQKAMEFIQSRGEDIFYLFQCTTRQGRNIKLLVRQSFDPRSTFYKLMKKYKTIKVGDEVNVFYNPEKRRYDFLL

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.