Scaffold QLn_FQAYR3Y02RD43M

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold QLn_FQAYR3Y02RD43M

Scaffold QLn_FQAYR3Y02RD43M

Overview

Basic Information
Taxon OID	2022920000 Open in IMG/M
Scaffold ID	QLn_FQAYR3Y02RD43M Open in IMG/M
Source Dataset Name	Saline water microbial communities from Qinghai Lake, Tibetan Plateau - High mountain lake (unassembled)
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Illinois, Urbana-Champaign
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	525
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From A Tibetan Plateau Lake

Source Dataset Sampling Location
Location Name	Qinghai Lake, Tibetan Plateau
Coordinates	Lat. (^o)	36.381	Long. (^o)	100.218	Alt. (m)		Depth (m)	1
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F032935	Metagenome / Metatranscriptome	178	Y

Sequences

Protein ID	Family	RBS	Sequence
QL_na_6271140	F032935	N/A	MSQISKLSFVDGKLGAPTSGQQTTRVLFNTIENPGTATSLTFFRSFQGLTNGQTNLTQNKLDSSESMVVKTVYLMQVTTSGSIQIFGELGLIAQQTMDIM

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.