NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold YNPsite05_CeleraDRAF_scf1119010634677

Scaffold YNPsite05_CeleraDRAF_scf1119010634677


Overview

Basic Information
Taxon OID2022920003 Open in IMG/M
Scaffold IDYNPsite05_CeleraDRAF_scf1119010634677 Open in IMG/M
Source Dataset NameHot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP5 Bath Lake Vista Annex
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)12224
Total Scaffold Genes16 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (12.50%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameYellowstone National Park, WY
CoordinatesLat. (o)44.96507Long. (o)-110.71215Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F061617Metagenome / Metatranscriptome131N

Sequences

Protein IDFamilyRBSSequence
YNPsite05_CeleraDRAFT_356740F061617N/AMAKTLNALANRKKVRTRQILNQSNLYYLNNRRLSFLPKIFLGFSIVLVICGLLWYLNVFDLQTVVGQPVSHQSEQLTALDLIRQLNSNTTSQANTTDEQTANWQSLNSDKLVLLTAQNGATCALSLQPNPPENIKPIVQNQPQGWWLPSHCAVSELVAVQIVRLNSTEANKLAQAANLIQVQNLDGLDTYAIIYFNQPSKTSFDLKKYLKSLTANIFTDRFYFNTTSAHDTKKIGDWIYYLDGECAGPSSYRDPCKLWRSDRNTGTIELLKKKRR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.