Scaffold YNPsite16_CeleraDRAF_scf1119010770530

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold YNPsite16_CeleraDRAF_scf1119010770530

Scaffold YNPsite16_CeleraDRAF_scf1119010770530

Overview

Basic Information
Taxon OID	2022920018 Open in IMG/M
Scaffold ID	YNPsite16_CeleraDRAF_scf1119010770530 Open in IMG/M
Source Dataset Name	Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP16 Fairy Spring Red Layer
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Draft

Scaffold Components
Scaffold Length (bps)	1341
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	2 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Archaea → Euryarchaeota → Stenosarchaea group → Halobacteria → Halobacteriales → Halobacteriaceae → Haladaptatus → Haladaptatus paucihalophilus → Haladaptatus paucihalophilus DX253	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location Name	Yellowstone National Park, WY
Coordinates	Lat. (^o)	44.533365	Long. (^o)	-110.849887	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F003460	Metagenome / Metatranscriptome	485	Y

Sequences

Protein ID	Family	RBS	Sequence
YNPsite16_CeleraDRAFT_501730	F003460	AGCAGG	MHDLQHAYEVLHEIIAPRGLYAESTLLLVVNLRRPSELRDVAVELVIRARAGGSPVWRANESLRVPGRMKLRSLAGALFGLFMRAAYDVEAQISLPGDDRPRSQGRARA

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.