Basic Information | |
---|---|
Taxon OID | 2022920020 Open in IMG/M |
Scaffold ID | YNPsite20_CeleraDRAF_scf1119010802839 Open in IMG/M |
Source Dataset Name | Hot spring microbial communities from Yellowstone National Park, Wyoming, USA - YNP20 Bath Lake Vista Annex - Purple-Sulfur Mats |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | DOE Joint Genome Institute (JGI) |
Sequencing Status | Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 14839 |
Total Scaffold Genes | 14 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (28.57%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Yellowstone National Park, WY | |||||||
Coordinates | Lat. (o) | 44.96507 | Long. (o) | -110.71215 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F073600 | Metagenome / Metatranscriptome | 120 | N |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
YNPsite20_CeleraDRAFT_187640 | F073600 | N/A | XFSDTKNRYIDFDKDEPVRIEGQIDLINLATSKLPNYLPDNPDTLFQSDFAVHLQDDAKMTKLNLKNPTSSQID |
⦗Top⦘ |