NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ASn_FUOFX6F01A0NS8

Scaffold ASn_FUOFX6F01A0NS8


Overview

Basic Information
Taxon OID2027040003 Open in IMG/M
Scaffold IDASn_FUOFX6F01A0NS8 Open in IMG/M
Source Dataset NameViral communities in wastewater treatment process (AS-no assmebly)
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterUniversity of Illinois, Urbana-Champaign
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)502
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → delta/epsilon subdivisions → Deltaproteobacteria → Desulfurellales → unclassified Desulfurellales → Desulfurellales bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Dissolved Organics (Aerobic) → Activated Sludge → Wastewater → Wastewater Viral Communities From Wastewater Treatment Facility In Singapore

Source Dataset Sampling Location
Location NameSingapore: Singapore
CoordinatesLat. (o)1.332Long. (o)103.756Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F060712Metagenome / Metatranscriptome132Y

Sequences

Protein IDFamilyRBSSequence
AS_na_2588140F060712GGAGGITTLTDIANRALQVPGTRTTVTDAELAGNTTNEAIQINLVADSIRRQLIRMAPWDSALKTANLVYISSTPGTPENTSAATTLWQPGQPSPPWAYEYQYPVDCLRACWIIPATQ
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.