Scaffold BlanesLi_DSAD-090629_plate103D02a_g1

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold BlanesLi_DSAD-090629_plate103D02a_g1

Scaffold BlanesLi_DSAD-090629_plate103D02a_g1

Overview

Basic Information
Taxon OID	2028778002 Open in IMG/M
Scaffold ID	BlanesLi_DSAD-090629_plate103D02a_g1 Open in IMG/M
Source Dataset Name	Marine surface waters microbial communities from Blanes Bay, Balearic Sea - 299
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Washington University in St. Louis
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	928
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Oceanic → Photic Zone → Marine Surface Waters → Marine Surface Waters Microbial Communities From Blanes Bay, Balearic Sea

Source Dataset Sampling Location
Location Name	Blanes Bay, Balearic Sea
Coordinates	Lat. (^o)	41.670501	Long. (^o)	2.800182	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F040177	Metagenome	162	Y

Sequences

Protein ID	Family	RBS	Sequence
Blanes_lib_50320	F040177	GAG	MKTNEHTKNFKDYFWSFYGPEVGIYKDFFNNNLTIKELDRALKIRLSNMKLEFDGDSIDREIIRDIIFKLRDPKSKTEHKFNFKIK

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.