NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ErSWdraf_F5BXKTZ02HMFQI

Scaffold ErSWdraf_F5BXKTZ02HMFQI


Overview

Basic Information
Taxon OID2035265000 Open in IMG/M
Scaffold IDErSWdraf_F5BXKTZ02HMFQI Open in IMG/M
Source Dataset NameFreshwater microbial communities from Swedish Lakes - surface of Lake Erken
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterRoyal Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)511
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater → Freshwater Microbial Communities From Swedish Lakes

Source Dataset Sampling Location
Location NameLake Erken, Sweden
CoordinatesLat. (o)59.84Long. (o)18.63Alt. (m)Depth (m)0 to 2
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F038235Metagenome166N

Sequences

Protein IDFamilyRBSSequence
ErSWdraft_5008480F038235N/AMIREILAPFERVTYVREDGNQAVYKVFRPTKHLFTNKKRDNGRVVGFRAWKMPDTGADERMGWRSFRFDRIASRKLTFI
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.