Scaffold Coalbed1143_GAIGPUK01AL2EJ

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Coalbed1143_GAIGPUK01AL2EJ

Scaffold Coalbed1143_GAIGPUK01AL2EJ

Overview

Basic Information
Taxon OID	2038011002 Open in IMG/M
Scaffold ID	Coalbed1143_GAIGPUK01AL2EJ Open in IMG/M
Source Dataset Name	Coalbed microbial communities from New Mexico, USA - 343
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Virginia Polytechnic Institute and State University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	501
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Groundwater → Coalbed Water → Coalbed Water → Coalbed Water Microbial Communities From New Mexico, Usa

Source Dataset Sampling Location
Location Name	New Mexico
Coordinates	Lat. (^o)	36.728056	Long. (^o)	-108.220833	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F019851	Metagenome	227	N

Sequences

Protein ID	Family	RBS	Sequence
Coalbed5_716770	F019851	GAGG	VKRPDQVCESCWRVSRASSVPVTEIACHHNKVLATWHADTDEWTYQHRVARKRPTQKQSEQLAKMFDQAGAATRRRDET

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.