NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold ACOD_F64RS5002JV3PJ

Scaffold ACOD_F64RS5002JV3PJ


Overview

Basic Information
Taxon OID2040502000 Open in IMG/M
Scaffold IDACOD_F64RS5002JV3PJ Open in IMG/M
Source Dataset NameFungus garden microbial communities from Atta colombica in Panama - dump bottom
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences, DOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)516
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Arthropoda → Symbiotic Fungal Gardens And Galleries → Fungus Garden → Unclassified → Fungus Garden → Fungus Garden Microbial Communities From Leaf-Cutting Ants In Gamboa, Panama

Source Dataset Sampling Location
Location NameGamboa, Panama
CoordinatesLat. (o)9.1167Long. (o)-79.7Alt. (m)Depth (m).5
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F018685Metagenome / Metatranscriptome233Y

Sequences

Protein IDFamilyRBSSequence
ACODB_6991740F018685GAGGMWRPNEPVVEDISGLPGNDLQNKRHRSRRRAWRNGLADQTVVQTLEDVRSYRAFERDLIGSVDPRS
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.