NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold 2044874655

Scaffold 2044874655


Overview

Basic Information
Taxon OID2044078008 Open in IMG/M
Scaffold ID2044874655 Open in IMG/M
Source Dataset NameMixed alcohol bioreactor microbial communities from Texas A and M University - 55C, Day 16
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)760
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Biotransformation → Mixed Alcohol Bioreactor → Unclassified → Unclassified → Mixed Alcohol Bioreactor → Mixed Alcohol Bioreactor Microbial Communities From Texas A&M University

Source Dataset Sampling Location
Location NameTexas A and M University College Station, Texas, USA
CoordinatesLat. (o)30.620833Long. (o)-96.341111Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F091897Metagenome / Metatranscriptome107Y

Sequences

Protein IDFamilyRBSSequence
2044913172F091897AGGAGMIGSSIPTFLNIQYQCCKCGKDLGDKYSRLKGKKQPDVNIIKGKLYCNKCADKHWND

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.