NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MiccSRB_F31IBB102JPA5U

Scaffold MiccSRB_F31IBB102JPA5U


Overview

Basic Information
Taxon OID2044078019 Open in IMG/M
Scaffold IDMiccSRB_F31IBB102JPA5U Open in IMG/M
Source Dataset NameConcrete drainage pipe biofilm microbial communities from Ohio, US, sample, 12383
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)551
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Source Dataset Sampling Location
Location NameOhio
CoordinatesLat. (o)Long. (o)Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F031548Metagenome / Metatranscriptome182Y

Sequences

Protein IDFamilyRBSSequence
MiccSRB2853410F031548N/AVTFVGGGVAMADGWKGEGGRKGHAYGHYKHGGYPHHGYCAPRPVYVERQYYPVVIERHVYHPAPSGYFFGMSVVEPGVAFSFGVSGR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.