NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MiccSOB_F3TY2AH01ATZ1Z

Scaffold MiccSOB_F3TY2AH01ATZ1Z


Overview

Basic Information
Taxon OID2046860001 Open in IMG/M
Scaffold IDMiccSOB_F3TY2AH01ATZ1Z Open in IMG/M
Source Dataset NameConcrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)505
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (66.67%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.8Long. (o)-84.3Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F002967Metagenome / Metatranscriptome517Y

Sequences

Protein IDFamilyRBSSequence
MiccSOB_9867890F002967GAGGVSTTVWLSPSATSFACLCETCLEAARTGGALFADALRAASVRGNVDADAPRSIVRCGAGHEIVLQRGERPPGLSRRDERQLQLT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.