Scaffold mhc6b_MHC6B_contig24408

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold mhc6b_MHC6B_contig24408

Scaffold mhc6b_MHC6B_contig24408

Overview

Basic Information
Taxon OID	2051223007 Open in IMG/M
Scaffold ID	mhc6b_MHC6B_contig24408 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Orebro University Hospital, Sweden - Sample 10375
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	University of Maryland School of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	542
Total Scaffold Genes	1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Orebro University Hospital, Sweden, Of Individuals With Crohns Disease

Source Dataset Sampling Location
Location Name	Orebro University Hospital, Sweden
Coordinates	Lat. (^o)	59.274717	Long. (^o)	15.230656	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F077320	Metagenome	117	N

Sequences

Protein ID	Family	RBS	Sequence
MHC6B_contig24408_metagene_gene_1	F077320	N/A	MVGIAVWRIWQTPRPVVLHRQDAWLSSAEPEMVDTLPDNAFTAELPEEIDGRLLYIRDYSASGHYQIVWEGVSAEAAESYLTALLDKGFTRLMGTAEDIASGVLLARGDLTLSISLSGGTLNMLMTRAEEPTTTPLP

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.