NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GSLSAAI_contig14170

Scaffold GSLSAAI_contig14170


Overview

Basic Information
Taxon OID2058419001 Open in IMG/M
Scaffold IDGSLSAAI_contig14170 Open in IMG/M
Source Dataset NameSaline water microbial communities from Great Salt Lake, Utah, sample from South Arm Antelope Island 1
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1183
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)4 (80.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
Not Available(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water → Saline Water Microbial Communities From Great Salt Lake, Utah

Source Dataset Sampling Location
Location NameGreat Salt Lake, Utah
CoordinatesLat. (o)41.454358Long. (o)-112.666397Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F073153Metagenome120N

Sequences

Protein IDFamilyRBSSequence
GSLSAAI_00682940F073153N/AMSEQDMPVRDEIARIDGNIEGILTRLGQQGESVARLDLLVEEMKEMNQQLEHIEIRLNTLEGRID
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.