Scaffold bke_il_velvet_contig_87119

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold bke_il_velvet_contig_87119

Scaffold bke_il_velvet_contig_87119

Overview

Basic Information
Taxon OID	2065487000 Open in IMG/M
Scaffold ID	bke_il_velvet_contig_87119 Open in IMG/M
Source Dataset Name	Human fecal microbial communities from Baylor School of Medicine, Texas, USA, mock community - bke_il_velvet
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Baylor College of Medicine
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	1206
Total Scaffold Genes	3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Bacteroidia → Bacteroidales → Bacteroidaceae → Bacteroides → unclassified Bacteroides → Bacteroides sp.	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Human → Digestive System → Large Intestine → Fecal → Human Fecal → Human Fecal Microbial Communities From Baylor College Of Medicine, Texas, Usa, Mock Community

Source Dataset Sampling Location
Location Name	Baylor School of Medicine, Houston, Texas, USA
Coordinates	Lat. (^o)	29.7	Long. (^o)	-95.38	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F051936	Metagenome	143	N

Sequences

Protein ID	Family	RBS	Sequence
bke_il_velvet_01029930	F051936	N/A	GQVLFFLLAPRGKAFGFSGLSETAVMTPVIINFSLLLIIR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.