NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GPWSG_F5G3JLY01C15HP

Scaffold GPWSG_F5G3JLY01C15HP


Overview

Basic Information
Taxon OID2067725003 Open in IMG/M
Scaffold IDGPWSG_F5G3JLY01C15HP Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Wisconsin, Switchgrass soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)503
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium 13_2_20CM_2_64_7(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameIowa, USA
CoordinatesLat. (o)43.303333Long. (o)-89.3325Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F029854Metagenome / Metatranscriptome187Y
F059194Metagenome / Metatranscriptome134N

Sequences

Protein IDFamilyRBSSequence
GPWSG_01517110F059194N/APRRGRAPTPRERPFKLGPLGSLNQIIVALGKSIRAMADGTLDSQVGARICNGLGIMRACLETRKLEQLESRMDEIADRVANERTGAARERTSTHEAQHLSY
GPWSG_01517120F029854GAGGMKPSTFRIERLLAKVEAEVERRGLRARRYVFHPDEVAEAEAQGLPYVLLPRVLSRQEWIERYATPGAEAEFYA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.