NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold MiccSOB_contig04015

Scaffold MiccSOB_contig04015


Overview

Basic Information
Taxon OID2070309002 Open in IMG/M
Scaffold IDMiccSOB_contig04015 Open in IMG/M
Source Dataset NameConcrete drainage pipe biofilm microbial communities from Ohio, US - sample 12382, Newbler assembly
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing Center454 Life Sciences
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)3212
Total Scaffold Genes5 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)2 (40.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae → Acidiphilium → Acidiphilium cryptum(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Storm Water → Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm → Concrete Drainage Pipe Biofilm Microbial Communities From Ohio, Us

Source Dataset Sampling Location
Location NameOhio, USA
CoordinatesLat. (o)39.8Long. (o)-84.3Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F046787Metagenome150Y

Sequences

Protein IDFamilyRBSSequence
MiccSOB_00069900F046787N/AMSESDKPLRQQIDDAMAAIRKQIERLREGPTMGGPSDDRSVIADLQAEYQALAEVRTNLPPHDHPSDHPDDATPA

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.