NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold OSPC_contig01644

Scaffold OSPC_contig01644


Overview

Basic Information
Taxon OID2077657024 Open in IMG/M
Scaffold IDOSPC_contig01644 Open in IMG/M
Source Dataset NameHot spring microbial communities from One Hundred Springs Plain, Yellowstone National Park, Wyoming, USA - OSP_C
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)1190
Total Scaffold Genes3 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (33.33%)
Associated Families3

Taxonomy
All Organisms → Viruses → Predicted Viral(Source: DeepVirFinder)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Hot Spring → Hot Spring Microbial Communities From Yellowstone National Park, Wyoming, Usa

Source Dataset Sampling Location
Location NameOne Hundred Springs Plain, Yellowstone National Park
CoordinatesLat. (o)44.7315Long. (o)-110.711389Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F075084Metagenome / Metatranscriptome119N
F080245Metagenome115N
F087442Metagenome / Metatranscriptome110N

Sequences

Protein IDFamilyRBSSequence
OSPC_00049790F087442N/AGETRMMREGLVKAGNLVVDCKPCYVAGTGFTKDDIYVISEGTVVFKWYDKIAVVVVGEEGMKVNLLDIVDVRFLVERNENCLATRL
OSPC_00049800F080245N/AMIFVWSARVVIPGFRDEVFVSPALINRYIELTEDVYEVGMFMVPHKGHALLFLPTMVIKVDDELMKNLEQTTIEDLNIPLNTISNVFT
OSPC_00049810F075084GAGVRPCRKDLCLLYSLGADYAKLIDFTNQNFQGKLFRAGARAMIYARRLMASWYGYDTGVLIETALRRILRRSITYCNIMRRLGLESEYCRRYTQYNGVPCDLVSVFTVETTYADILHMIVNYNSENVSKVLT
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.