Scaffold TAcon_WLES14.Sanger.454shreds._C1196

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold TAcon_WLES14.Sanger.454shreds._C1196

Scaffold TAcon_WLES14.Sanger.454shreds._C1196

Overview

Basic Information
Taxon OID	2081372008 Open in IMG/M
Scaffold ID	TAcon_WLES14.Sanger.454shreds._C1196 Open in IMG/M
Source Dataset Name	Wastewater bioreactor microbial communities from Singapore -TA reactor DNA contigs from 4 sample
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	842
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Caldiserica/Cryosericota group → Caldiserica → Caldisericia → Caldisericales → unclassified Caldisericales → Caldisericales bacterium	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Bioremediation → Terephthalate → Wastewater → Bioreactor → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Singapore And Univ Of Illinois At Urbana, That Are Terephthalate-Degrading

Source Dataset Sampling Location
Location Name	National University of Singapore, Singapore
Coordinates	Lat. (^o)	1.332	Long. (^o)	103.756	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F071272	Metagenome / Metatranscriptome	122	N

Sequences

Protein ID	Family	RBS	Sequence
TAcon_00416090	F071272	N/A	NHHQTAFGMAARIGNTAKARVYKAADDQLADSMAAGAWQDGPAPKDGSWILGLFYGLPYVVCYDSWEISEEGGPKETEEGWCLAGQDMHPMDQDEPEKWARIIHPNRHMPASWDGPGDQR

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.