NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold CNB_F6ESG4R02H3F94

Scaffold CNB_F6ESG4R02H3F94


Overview

Basic Information
Taxon OID2088090001 Open in IMG/M
Scaffold IDCNB_F6ESG4R02H3F94 Open in IMG/M
Source Dataset NameQuercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterBeijing Genomics Institute (BGI), Lifesequencing S.L.
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)525
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (100.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Host-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Quercus Rhizosphere → Quercus Rhizosphere Microbial Communities From Sierra Nevada National Park, Granada, Spain

Source Dataset Sampling Location
Location NameSierra Nevada National Park, Granada, Spain
CoordinatesLat. (o)36.94932Long. (o)-3.4176Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001022Metagenome / Metatranscriptome804Y

Sequences

Protein IDFamilyRBSSequence
CNB_02106790F001022GAGGMKVVEIVPRERTRLYGMLVAKEAAIRKGGRGTYVRVGRKTKDATRWKHRNYRGSVQLKRAASEVVTAKVQATTAEDERKLLSSFLGFVDRHSGDQVATITIHYR
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.