NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold LWSO2_GGWJX9X02IL72M

Scaffold LWSO2_GGWJX9X02IL72M


Overview

Basic Information
Taxon OID2088090006 Open in IMG/M
Scaffold IDLWSO2_GGWJX9X02IL72M Open in IMG/M
Source Dataset NameSediment microbial communities from Lake Washington, Seattle, for Methane and Nitrogen Cycles, original sample replicate 2
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)509
Total Scaffold Genes1 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater Sediment → Freshwater Sediment Microbial Communities From Lake Washington, Seattle, Usa, For Methane And Nitrogen Cycles

Source Dataset Sampling Location
Location NameLake Washington, Seattle
CoordinatesLat. (o)47.052Long. (o)-122.267889Alt. (m)Depth (m)62
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F083988Metagenome / Metatranscriptome112Y

Sequences

Protein IDFamilyRBSSequence
LWSO2_07732000F083988N/ALNHTILEAFDGPQLQGQVAVTSRYRLNAIRNEHWGEHWGHTDDELVDRLLVKKGGDDLAAAHQPDILV

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.