NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GPIPI_17191575

Scaffold GPIPI_17191575


Overview

Basic Information
Taxon OID2088090014 Open in IMG/M
Scaffold IDGPIPI_17191575 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1206
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Novel Protein Genes2 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)1 (50.00%)
Associated Families2

Taxonomy
All Organisms → cellular organisms → Bacteria(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F001244Metagenome / Metatranscriptome738Y
F023469Metagenome / Metatranscriptome210N

Sequences

Protein IDFamilyRBSSequence
GPIPI_01596200F001244GAGGMNGGDEPLPLGNPPVFEHTTPTGATEVAERLVAFPYIPPDVKLKEKEALSSSNDWFTKHDKNKIDQLGTLDFYASSGPQSVGVVAKLHNTSAGIEIYQLPPTLTKETFEKTEGPYRSGITKKYSNKRSGEKIAKFKAGTMAQSGLACFHMSRLLGHLVEVPPATYRTMDLQEFQKVGDQARTTGHPSCTEAWANLRAMAKSASPKLVLSGGKVVYGSLAQNPRGEDSSPEDYWTVGAIRGHSFY
GPIPI_01596210F023469N/ADLLEYFQNQTLMTSDEAKGVVARLQEVASILKENCDNGTLVFDSKPEIFLGMEPIPPKNC

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.