NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold GPIPI_17359880

Scaffold GPIPI_17359880


Overview

Basic Information
Taxon OID2088090014 Open in IMG/M
Scaffold IDGPIPI_17359880 Open in IMG/M
Source Dataset NameSoil microbial communities from Great Prairies - Iowa, Native Prairie soil
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusDraft

Scaffold Components
Scaffold Length (bps)1837
Total Scaffold Genes6 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)5 (83.33%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Grasslands → Soil → Soil Microbial Communities From Great Prairies (Kansas, Wisconsin And Iowa)

Source Dataset Sampling Location
Location NameUSA: Maryland: Natonal Institute of Health
CoordinatesLat. (o)39.0042816Long. (o)-77.1012173Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F000037Metagenome / Metatranscriptome4230Y
F004562Metagenome / Metatranscriptome433Y
F017394Metagenome / Metatranscriptome241Y

Sequences

Protein IDFamilyRBSSequence
GPIPI_02452550F017394GGGGGMTEVLNEVACGEPDQLAPSSDIVLGGSVPQKDAPSSLAALEDRDRRYELQAQQSLTAAFFGDPLPGRSALDRRRAEQERTARQSGG
GPIPI_02452560F000037GAGGLDKDYLTLKRASASRPSGDWNDDDFDVLADGVVVGRIMKAAAVPVGMSWMWTLAFEHHEDRIPTRGYAATREAAMAAFAKSWRRE
GPIPI_02452570F004562AGGMSTTVLAYLILFMGFITFLAGAFGALMLLFEEVTKTERVPFRYYAMMVGLISGGLGLIGIGQGLRLLLLILGKE
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.